Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_017_D07 (549 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P38067|UGA2_YEAST Succinate-semialdehyde dehydrogenase [... 31 1.7 sp|Q7YR73|ICOS_CANFA Inducible T-cell co-stimulator precurs... 30 3.0
>sp|P38067|UGA2_YEAST Succinate-semialdehyde dehydrogenase [NADP+] (SSDH) Length = 497 Score = 31.2 bits (69), Expect = 1.7 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 225 LHDPAKLYEMNAINDKWIDGSDTVKTMEAVDPIEGTI 335 L+DP E I+ KW+ G+D V E VDP G I Sbjct: 11 LNDPNLFRESGYIDGKWVKGTDEV--FEVVDPASGEI 45
>sp|Q7YR73|ICOS_CANFA Inducible T-cell co-stimulator precursor (Activation-inducible lymphocyte immunomediatory molecule) Length = 208 Score = 30.4 bits (67), Expect = 3.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -2 Query: 467 CCNFNSFYIIGSIGFRCLSLHFCIGYCWLRIRNYRS 360 CC + IG F + + CI CWL + YRS Sbjct: 136 CCQLKFWLPIGCAAFVVVYIFGCIFLCWLTKKKYRS 171
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,161,974 Number of Sequences: 369166 Number of extensions: 582199 Number of successful extensions: 1366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1364 length of database: 68,354,980 effective HSP length: 104 effective length of database: 49,142,540 effective search space used: 3833118120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)