DrC_00603
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00603 (732 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9UGU0|TCF20_HUMAN Transcription factor 20 (Stromelysin ... 35 0.27 sp|Q6CFS5|CBK1_YARLI Serine/threonine-protein kinase CBK1 32 1.3 sp|Q9EPQ8|TCF20_MOUSE Transcription factor 20 (Stromelysin ... 32 1.7 sp|Q9Y2J4|AMOL2_HUMAN Angiomotin-like protein 2 (Leman coil... 31 3.9 sp|Q12527|ATG11_YEAST Autophagy-related protein 11 (Cytopla... 30 5.1 sp|Q9K7G2|Y3399_BACHD Hypothetical protein BH3399 30 6.6 sp|Q07292|KRAF1_CAEEL Raf homolog serine/threonine-protein ... 30 8.6 sp|Q9Y805|CWC25_SCHPO Pre-mRNA splicing factor cwc25 (Compl... 30 8.6 sp|P53131|PRP43_YEAST Pre-mRNA splicing factor RNA helicase... 30 8.6
>sp|Q9UGU0|TCF20_HUMAN Transcription factor 20 (Stromelysin 1 PDGF-responsive element-binding protein) (Spre-binding protein) (Nuclear factor SPBP) (AR1) Length = 1960 Score = 34.7 bits (78), Expect = 0.27 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 353 HDVISNYSPADSVSTQMRRIERRLDGMMDYKFPEPEYFSDLRKNL 487 HD +S+Y P DS T MRR+ R+ G + P + D + L Sbjct: 972 HDSLSDYGPQDSRPTPMRRVPGRVGGREGMRGRSPSQYHDFAEKL 1016
>sp|Q6CFS5|CBK1_YARLI Serine/threonine-protein kinase CBK1 Length = 588 Score = 32.3 bits (72), Expect = 1.3 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 4/109 (3%) Frame = +2 Query: 221 RYRVLNSTERQITSHHRPGFVRSSSERPGEIS----DHQQFTSRQRKHHDVISNYSPADS 388 R R N+T Q+ S + G V+ + ER S +Q TS +R++ V++NY ++ Sbjct: 136 RDRAHNTT--QVISTYYKGIVQHAIERHQRRSAAEASVEQATSEERRNR-VLTNYGKKET 192 Query: 389 VSTQMRRIERRLDGMMDYKFPEPEYFSDLRKNLSSINNRLATHRNMIDK 535 +MRR L+ + K F ++R N ++ + M+ K Sbjct: 193 AYLRMRRTRMALEDFVTVKVIGKGAFGEVRLVQKRDNGKIYAMKTMLKK 241
>sp|Q9EPQ8|TCF20_MOUSE Transcription factor 20 (Stromelysin 1 PDGF-responsive element-binding protein) (Spre-binding protein) (Nuclear factor SPBP) Length = 1983 Score = 32.0 bits (71), Expect = 1.7 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +2 Query: 353 HDVISNYSPADSVSTQMRRIERRLDGMMDYKFPEPEYFSDLRKNL 487 HD IS+Y P DS ST MRR+ R+ + + D + L Sbjct: 1000 HDSISDYGPQDSRSTPMRRVPGRVGSRETMRGRSSSQYHDFAEKL 1044
>sp|Q9Y2J4|AMOL2_HUMAN Angiomotin-like protein 2 (Leman coiled-coil protein) (LCCP) Length = 779 Score = 30.8 bits (68), Expect = 3.9 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 1/79 (1%) Frame = +2 Query: 281 VRSSSERPGEISDHQQFTSRQRKHHDVISNYSPADSVSTQMRRIERRLDGMMDYKFPEPE 460 + SS+E+ G I + R + H+ ++ S++ +E+ + MD + + Sbjct: 335 LESSAEKAGRIEKLESEIQRLSEAHESLTR------ASSKREALEKTMRNKMDSEMRRLQ 388 Query: 461 YFS-DLRKNLSSINNRLAT 514 F+ DLR+ L S N RLA+ Sbjct: 389 DFNRDLRERLESANRRLAS 407
>sp|Q12527|ATG11_YEAST Autophagy-related protein 11 (Cytoplasm to vacuole targeting protein 9) Length = 1178 Score = 30.4 bits (67), Expect = 5.1 Identities = 14/59 (23%), Positives = 32/59 (54%) Frame = +2 Query: 395 TQMRRIERRLDGMMDYKFPEPEYFSDLRKNLSSINNRLATHRNMIDKYSSVDMGTVVPL 571 T + R +R + +++ + F R+N++S+ + ++ ++ +SSVD+ T PL Sbjct: 1018 TLLERFQREKVTLRNFQIGDLALFLPTRENVNSVGSMSSSTSSLSSSFSSVDLSTPPPL 1076
>sp|Q9K7G2|Y3399_BACHD Hypothetical protein BH3399 Length = 329 Score = 30.0 bits (66), Expect = 6.6 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +2 Query: 407 RIERRLDGMMDYKFPEPEYFSDLRKNLSSI--NNRLATHRN 523 R+ R +D DY EP Y DLRKNL S+ N RL+ +N Sbjct: 289 RLLRSVD--KDYSKEEPGYLMDLRKNLVSLINNYRLSFEQN 327
>sp|Q07292|KRAF1_CAEEL Raf homolog serine/threonine-protein kinase (Abnormal cell lineage protein 45) Length = 813 Score = 29.6 bits (65), Expect = 8.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 272 PGFVRSSSERPGEISDHQQFTSRQRKHHD 358 PGF R+ S PGE D Q+ Q+ HH+ Sbjct: 444 PGFFRNRSRSPGERLDAQRPRPPQKPHHE 472
>sp|Q9Y805|CWC25_SCHPO Pre-mRNA splicing factor cwc25 (Complexed with cdc5 protein 25) (Cell cycle control protein cwf25) Length = 376 Score = 29.6 bits (65), Expect = 8.6 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +2 Query: 215 RRRYRVLNSTERQITSHHRPGFVRSSSERPGEISDHQQFTSRQRKH 352 +R+Y L+S + HR RS+ +R E SD++Q +S +R+H Sbjct: 156 KRKYS-LDSDRKSKERRHRDRHHRSNQDRSRERSDNEQHSSDKREH 200
>sp|P53131|PRP43_YEAST Pre-mRNA splicing factor RNA helicase PRP43 (Helicase JA1) Length = 767 Score = 29.6 bits (65), Expect = 8.6 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Frame = +2 Query: 344 RKHHDVISNYSPADSVSTQMRRIERRLD---GMMDYKFPEPEYFSDLRKNLSS 493 R H+ + S AD++ +Q+ R+ R + DY+ P+YF ++RK L+S Sbjct: 604 RDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYE--SPKYFDNIRKALAS 654
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 69,771,918
Number of Sequences: 369166
Number of extensions: 1271016
Number of successful extensions: 3327
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 3257
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3326
length of database: 68,354,980
effective HSP length: 108
effective length of database: 48,403,600
effective search space used: 6534486000
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
