DrC_00569
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00569 (1313 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q96WL3|URE2_CANAL Protein URE2 34 1.1 sp|P48361|ASK10_YEAST Protein ASK10 33 2.4 sp|P65283|LIPA_MYCTU Lipoyl synthase (Lipoic acid synthase)... 32 4.1 sp|P34127|MYBH_DICDI Myb-like protein 32 4.1
>sp|Q96WL3|URE2_CANAL Protein URE2 Length = 344 Score = 33.9 bits (76), Expect = 1.1 Identities = 26/106 (24%), Positives = 49/106 (46%), Gaps = 8/106 (7%) Frame = +2 Query: 164 NVSPATNNTEQMGANIPDNLQNNQSMQRSIMPTANKSIVNGNIPIPTKEQIQTVQQV--- 334 N++ +NN+ N +N NNQS+ ++ T N + N+ K T QQ Sbjct: 11 NMNDNSNNSNNSNNNNTNNNNNNQSVNVNVNNTNNNTQTISNLSAGLKSVSLTDQQQNEV 70 Query: 335 -IGSIKRNYPQE----MQNDKFTEWLKNNPSYKATFQLYSLKKSPS 457 + +++ QE Q + T++ +N P+ F L+S + +P+ Sbjct: 71 NLNLLQQQLHQEASTQQQQSRITQFFQNQPT--EGFTLFSHRSAPN 114
>sp|P48361|ASK10_YEAST Protein ASK10 Length = 1146 Score = 32.7 bits (73), Expect = 2.4 Identities = 24/103 (23%), Positives = 48/103 (46%), Gaps = 9/103 (8%) Frame = +2 Query: 119 DIANLQRMQTSSLLNNVSPATNNTEQMGANIPDNLQNNQSMQRSIMPTANKSIVNGNIPI 298 D A+ ++S L ++ P + + ++I + NNQ+ + + T +S N+PI Sbjct: 27 DDASSIHSKSSQYLMDILPDSMTLNESVSSI---VANNQAKEFILPETDERSPYFINVPI 83 Query: 299 P---------TKEQIQTVQQVIGSIKRNYPQEMQNDKFTEWLK 400 P TK+ + + + G + YP ++ D+F +W K Sbjct: 84 PKAQPTSTTETKKPLAGDEAIDGQFVKEYPTDILVDRFYKWKK 126
>sp|P65283|LIPA_MYCTU Lipoyl synthase (Lipoic acid synthase) (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) sp|P65284|LIPA_MYCBO Lipoyl synthase (Lipoic acid synthase) (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 311 Score = 32.0 bits (71), Expect = 4.1 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -1 Query: 782 LVDIGC-IEIVIQILRRLTNPHCILLWIVTGEFV*FERFTANCHLPGLLDGWLI 624 L D GC I + Q LR H + W+ EFV F RF G+L G L+ Sbjct: 236 LRDAGCDIVTITQYLRPSARHHPVERWVKPEEFVQFARFAEGLGFAGVLAGPLV 289
>sp|P34127|MYBH_DICDI Myb-like protein Length = 451 Score = 32.0 bits (71), Expect = 4.1 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = +2 Query: 149 SSLLNNVSPATNNTEQMGANIPDNLQNNQSMQRSIMPTANKSIVNGNIPIPTKEQ 313 ++L+NN++ NN M N+ +N NN +M +I N +I N N P K++ Sbjct: 97 NNLINNIN---NNINNMNNNMNNN-NNNNNMNNNINNNGNSNISNNNTPKVEKKK 147
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 122,407,101
Number of Sequences: 369166
Number of extensions: 2172131
Number of successful extensions: 4887
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4630
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4876
length of database: 68,354,980
effective HSP length: 114
effective length of database: 47,295,190
effective search space used: 15276346370
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
