DrC_00495
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00495 (513 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O18842|MT_BALMY Metallothionein (MT) 31 2.0 sp|P55943|MT2H_BOVIN Metallothionein-II, hippocampal (MT-2) 31 2.0 sp|P02797|MT1_CERAE Metallothionein-1 (MT-1) (Metallothione... 30 3.3 sp|P13640|MT1G_HUMAN Metallothionein-IG (MT-1G) 30 3.3 sp|P02798|MT2_MOUSE Metallothionein-2 (MT-2) (Metallothione... 30 3.3 sp|P04731|MT1A_HUMAN Metallothionein-IA (MT-1A) 30 4.4 sp|P04733|MT1F_HUMAN Metallothionein-IF (MT-1F) 30 4.4 sp|P68302|MT2_SHEEP Metallothionein-2 (MT-2) (Metallothione... 30 4.4 sp|P11957|MT1A_RABIT Metallothionein-1A (MT-1A) (Metallothi... 30 4.4 sp|O43439|MTG8R_HUMAN Protein CBFA2T2 (MTG8-like protein) (... 30 4.4
>sp|O18842|MT_BALMY Metallothionein (MT) Length = 61 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 213 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGCSSP 317 NC C + SC C +C K C +SCC C P Sbjct: 4 NCSCAAGGSCTCAGSCKCKECKCTSCKKSCCSCCPP 39
>sp|P55943|MT2H_BOVIN Metallothionein-II, hippocampal (MT-2) Length = 61 Score = 30.8 bits (68), Expect = 2.0 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 213 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 308 NC C + SC C N C K C +SCC C Sbjct: 4 NCSCATGGSCTCANSCTCKACKCASCKKSCCSC 36
>sp|P02797|MT1_CERAE Metallothionein-1 (MT-1) (Metallothionein-I) (MT-I) Length = 61 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 213 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 308 NC C + SC C + +C K C +SCC C Sbjct: 4 NCSCATGVSCTCADSCKCKECKCTSCKKSCCSC 36
>sp|P13640|MT1G_HUMAN Metallothionein-IG (MT-1G) Length = 61 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 213 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 308 NC C + SC C + +C K C +SCC C Sbjct: 4 NCSCAAGVSCTCASSCKCKECKCTSCKKSCCSC 36
>sp|P02798|MT2_MOUSE Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II) Length = 61 Score = 30.0 bits (66), Expect = 3.3 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 213 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 308 NC C S SC C +C K C +SCC C Sbjct: 4 NCSCASDGSCSCAGACKCKQCKCTSCKKSCCSC 36
>sp|P04731|MT1A_HUMAN Metallothionein-IA (MT-1A) Length = 61 Score = 29.6 bits (65), Expect = 4.4 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 213 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 308 NC C + SC C +C K C +SCC C Sbjct: 4 NCSCATGGSCTCTGSCKCKECKCNSCKKSCCSC 36
>sp|P04733|MT1F_HUMAN Metallothionein-IF (MT-1F) Length = 61 Score = 29.6 bits (65), Expect = 4.4 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 213 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 308 NC C + SC C +C K C +SCC C Sbjct: 4 NCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSC 36
>sp|P68302|MT2_SHEEP Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II) Length = 61 Score = 29.6 bits (65), Expect = 4.4 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 213 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 308 NC C + SC C +C K C +SCC C Sbjct: 4 NCSCTAGESCTCAGSCKCKDCKCASCKKSCCSC 36
>sp|P11957|MT1A_RABIT Metallothionein-1A (MT-1A) (Metallothionein-IA) (MT-IA) Length = 61 Score = 29.6 bits (65), Expect = 4.4 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 213 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 308 NC C + SC C + +C K C +SCC C Sbjct: 4 NCSCATGNSCTCASSCKCKECKCTSCKKSCCSC 36
>sp|O43439|MTG8R_HUMAN Protein CBFA2T2 (MTG8-like protein) (MTG8-related protein 1) (Myeloid translocation related protein 1) (ETO homologous on chromosome 20) (p85) Length = 604 Score = 29.6 bits (65), Expect = 4.4 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -2 Query: 272 PKAALHPIITAGVEAPAVTVPNTNPAAE*HVTTPAAQH 159 P + I A +PA+TVP NP + H T P QH Sbjct: 256 PAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQH 293
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,820,415
Number of Sequences: 369166
Number of extensions: 923238
Number of successful extensions: 2729
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 2521
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2721
length of database: 68,354,980
effective HSP length: 103
effective length of database: 49,327,275
effective search space used: 3304927425
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
