Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_006_H03 (340 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O18842|MT_BALMY Metallothionein (MT) 31 1.0 sp|P55943|MT2H_BOVIN Metallothionein-II, hippocampal (MT-2) 31 1.0 sp|P02797|MT1_CERAE Metallothionein-1 (MT-1) (Metallothione... 30 1.7 sp|P13640|MT1G_HUMAN Metallothionein-IG (MT-1G) 30 1.7 sp|P02798|MT2_MOUSE Metallothionein-2 (MT-2) (Metallothione... 30 1.7 sp|P04731|MT1A_HUMAN Metallothionein-IA (MT-1A) 30 2.3 sp|P04733|MT1F_HUMAN Metallothionein-IF (MT-1F) 30 2.3 sp|P68302|MT2_SHEEP Metallothionein-2 (MT-2) (Metallothione... 30 2.3 sp|P11957|MT1A_RABIT Metallothionein-1A (MT-1A) (Metallothi... 30 2.3 sp|P80295|MT1I_HUMAN Metallothionein-II (MT-1I) 30 2.3
>sp|O18842|MT_BALMY Metallothionein (MT) Length = 61 Score = 30.8 bits (68), Expect = 1.0 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGCSSP 144 NC C + SC C +C K C +SCC C P Sbjct: 4 NCSCAAGGSCTCAGSCKCKECKCTSCKKSCCSCCPP 39
>sp|P55943|MT2H_BOVIN Metallothionein-II, hippocampal (MT-2) Length = 61 Score = 30.8 bits (68), Expect = 1.0 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 135 NC C + SC C N C K C +SCC C Sbjct: 4 NCSCATGGSCTCANSCTCKACKCASCKKSCCSC 36
>sp|P02797|MT1_CERAE Metallothionein-1 (MT-1) (Metallothionein-I) (MT-I) Length = 61 Score = 30.0 bits (66), Expect = 1.7 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 135 NC C + SC C + +C K C +SCC C Sbjct: 4 NCSCATGVSCTCADSCKCKECKCTSCKKSCCSC 36
>sp|P13640|MT1G_HUMAN Metallothionein-IG (MT-1G) Length = 61 Score = 30.0 bits (66), Expect = 1.7 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 135 NC C + SC C + +C K C +SCC C Sbjct: 4 NCSCAAGVSCTCASSCKCKECKCTSCKKSCCSC 36
>sp|P02798|MT2_MOUSE Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II) Length = 61 Score = 30.0 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 135 NC C S SC C +C K C +SCC C Sbjct: 4 NCSCASDGSCSCAGACKCKQCKCTSCKKSCCSC 36
>sp|P04731|MT1A_HUMAN Metallothionein-IA (MT-1A) Length = 61 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 135 NC C + SC C +C K C +SCC C Sbjct: 4 NCSCATGGSCTCTGSCKCKECKCNSCKKSCCSC 36
>sp|P04733|MT1F_HUMAN Metallothionein-IF (MT-1F) Length = 61 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 135 NC C + SC C +C K C +SCC C Sbjct: 4 NCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSC 36
>sp|P68302|MT2_SHEEP Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II) Length = 61 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 135 NC C + SC C +C K C +SCC C Sbjct: 4 NCSCTAGESCTCAGSCKCKDCKCASCKKSCCSC 36
>sp|P11957|MT1A_RABIT Metallothionein-1A (MT-1A) (Metallothionein-IA) (MT-IA) Length = 61 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 135 NC C + SC C + +C K C +SCC C Sbjct: 4 NCSCATGNSCTCASSCKCKECKCTSCKKSCCSC 36
>sp|P80295|MT1I_HUMAN Metallothionein-II (MT-1I) Length = 61 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 40 NCYCWSFYSC-CNNWMQCGFWKVYGCVRSCCGC 135 NC C + SC C +C K C +SCC C Sbjct: 4 NCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSC 36
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,137,016 Number of Sequences: 369166 Number of extensions: 615713 Number of successful extensions: 1647 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1645 length of database: 68,354,980 effective HSP length: 80 effective length of database: 53,576,180 effective search space used: 1714437760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)