DrC_00182
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00182 (314 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9XIE6|ALA3_ARATH Putative phospholipid-transporting ATP... 30 1.7 sp|Q63358|MYO9B_RAT Myosin-9B (Myosin IXb) (Unconventional ... 30 2.2 sp|Q9QY06|MYO9B_MOUSE Myosin-9B (Myosin IXb) (Unconventiona... 30 2.2 sp|Q7NK22|PYRF_GLOVI Orotidine 5'-phosphate decarboxylase (... 29 2.9 sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 28 5.0
>sp|Q9XIE6|ALA3_ARATH Putative phospholipid-transporting ATPase 3 (Aminophospholipid flippase 3) Length = 1213 Score = 30.0 bits (66), Expect = 1.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 67 KWRVTTVWRMSKCLQCRICGLFSITS 144 KWRV VW S Q +C LF TS Sbjct: 981 KWRVVAVWATSAVYQSLVCYLFVTTS 1006
>sp|Q63358|MYO9B_RAT Myosin-9B (Myosin IXb) (Unconventional myosin-9b) Length = 1980 Score = 29.6 bits (65), Expect = 2.2 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = +1 Query: 85 VWRMSKCLQCRICGLFSITSCCHRTDGYFMFNSSR 189 +W M K L C +C + C H+ Y + R Sbjct: 1613 IWLMDKALLCSVCKMTCHKKCVHKIQSYCSYTGRR 1647
>sp|Q9QY06|MYO9B_MOUSE Myosin-9B (Myosin IXb) (Unconventional myosin-9b) Length = 2114 Score = 29.6 bits (65), Expect = 2.2 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = +1 Query: 85 VWRMSKCLQCRICGLFSITSCCHRTDGYFMFNSSR 189 +W M K L C +C + C H+ Y + R Sbjct: 1611 IWLMDKALLCSVCKMTCHKKCVHKIQSYCSYTGRR 1645
>sp|Q7NK22|PYRF_GLOVI Orotidine 5'-phosphate decarboxylase (OMP decarboxylase) (OMPDCase) (OMPdecase) Length = 237 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +2 Query: 35 AMIIIILFNQINGGLLPYGACQSVCNAGYVACLASLAVATGPMAISCS 178 A++ + L ++ LL +V +GYV LA LAV++G + CS Sbjct: 116 AVLAVTLLTSLDAQLLEQQLLVNVGVSGYVEHLAVLAVSSGVQGVVCS 163
>sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 Length = 315 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -1 Query: 161 SVLWQQLVMLNKPHILHCKHFDMR 90 SVLWQ L LN HI +C H D++ Sbjct: 105 SVLWQTLQALNFCHIHNCIHRDIK 128
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,014,577
Number of Sequences: 369166
Number of extensions: 610029
Number of successful extensions: 1424
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1379
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1423
length of database: 68,354,980
effective HSP length: 73
effective length of database: 54,869,325
effective search space used: 1700949075
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
