Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00179 (847 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P37642|YHJD_ECOLI Inner membrane protein yhjD 30 8.4
>sp|P37642|YHJD_ECOLI Inner membrane protein yhjD Length = 337 Score = 30.0 bits (66), Expect = 8.4 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +1 Query: 550 RLEMQYKISRNYFYFLFVIPILIVVCLAALCYRLKHPHIVARETDIVLKN 699 RL Q+ + YF FL +IPIL+V A HP ++ D +L+N Sbjct: 64 RLGNQFGAAITYFSFLSMIPILMVSFAAGGFVLASHPMLLQDIFDKILQN 113
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,735,707 Number of Sequences: 369166 Number of extensions: 1748054 Number of successful extensions: 4381 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4381 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 8293644780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)