Planaria EST Database


DrC_00179

BLASTX 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_00179
         (847 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P37642|YHJD_ECOLI  Inner membrane protein yhjD                  30   8.4  
>sp|P37642|YHJD_ECOLI Inner membrane protein yhjD
          Length = 337

 Score = 30.0 bits (66), Expect = 8.4
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = +1

Query: 550 RLEMQYKISRNYFYFLFVIPILIVVCLAALCYRLKHPHIVARETDIVLKN 699
           RL  Q+  +  YF FL +IPIL+V   A       HP ++    D +L+N
Sbjct: 64  RLGNQFGAAITYFSFLSMIPILMVSFAAGGFVLASHPMLLQDIFDKILQN 113
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 88,735,707
Number of Sequences: 369166
Number of extensions: 1748054
Number of successful extensions: 4381
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4246
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4381
length of database: 68,354,980
effective HSP length: 109
effective length of database: 48,218,865
effective search space used: 8293644780
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Cluster detail

DrC_00179

  1. Dr_sW_005_G07
  2. Dr_sW_005_I21
  3. Dr_sW_028_P08