Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_028_P08 (723 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P37642|YHJD_ECOLI Inner membrane protein yhjD 30 6.5 sp|Q8JIY1|ADA10_XENLA ADAM 10 precursor (A disintegrin and ... 30 8.5
>sp|P37642|YHJD_ECOLI Inner membrane protein yhjD Length = 337 Score = 30.0 bits (66), Expect = 6.5 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = +3 Query: 426 RLEMQYKISRNYFYFLFVIPILIVVCLAALCYRLKHPHIVARETDIVLKN 575 RL Q+ + YF FL +IPIL+V A HP ++ D +L+N Sbjct: 64 RLGNQFGAAITYFSFLSMIPILMVSFAAGGFVLASHPMLLQDIFDKILQN 113
>sp|Q8JIY1|ADA10_XENLA ADAM 10 precursor (A disintegrin and metalloproteinase domain 10) (Kuzbanian protein homolog) (xKuz) Length = 749 Score = 29.6 bits (65), Expect = 8.5 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +3 Query: 273 SVSSVFSNSENPCFNENTTFMSKTETYGNGSCDPGKPDKYQFVNSCQDE 419 ++S V EN CF E S GNG +PG+ + + C+DE Sbjct: 440 NISQVLDKKENSCFVE-----SGQPICGNGLVEPGEQCDCGYSDQCKDE 483
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,512,912 Number of Sequences: 369166 Number of extensions: 1608238 Number of successful extensions: 4168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4168 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 6462248555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)