Planaria EST Database


DrC_00138

BLASTX 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_00138
         (567 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q81GK4|CLS2_BACCR  Cardiolipin synthetase 2 (Cardiolipin ...    29   9.3  
>sp|Q81GK4|CLS2_BACCR Cardiolipin synthetase 2 (Cardiolipin synthase 2) (CL synthase 2)
          Length = 514

 Score = 28.9 bits (63), Expect = 9.3
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +1

Query: 172 QINVLKVSKQTKTIHLLMGPETFKKFVIGLKR 267
           ++  L +S QT+T  L  G ETF+  + GLKR
Sbjct: 141 RLGALNISFQTETRTLTNGDETFRAILNGLKR 172
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,929,489
Number of Sequences: 369166
Number of extensions: 469580
Number of successful extensions: 684
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 680
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 684
length of database: 68,354,980
effective HSP length: 104
effective length of database: 49,142,540
effective search space used: 4127973360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Cluster detail

DrC_00138

  1. Dr_sW_019_H22
  2. Dr_sW_004_H18
  3. Dr_sW_022_A12