Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_019_H22 (351 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P91907|GPA15_CAEEL Guanine nucleotide-binding protein al... 29 2.9 sp|Q9RH41|RPOB_RICCN DNA-directed RNA polymerase beta chain... 29 3.8 sp|Q9RH43|RPOB_RICMA DNA-directed RNA polymerase beta chain... 29 3.8 sp|Q61DE0|GPA15_CAEBR Guanine nucleotide-binding protein al... 28 5.0 sp|Q81GK4|CLS2_BACCR Cardiolipin synthetase 2 (Cardiolipin ... 28 6.5 sp|Q81TR2|CLS2_BACAN Cardiolipin synthetase 2 (Cardiolipin ... 28 8.5
>sp|P91907|GPA15_CAEEL Guanine nucleotide-binding protein alpha-15 subunit Length = 356 Score = 29.3 bits (64), Expect = 2.9 Identities = 19/79 (24%), Positives = 33/79 (41%) Frame = -1 Query: 243 TLSLFNPITNFLNVSGPINRWIVLVCFDTFNTFIKYFADNFKTSIASFLFSTFTSTNLYP 64 ++ LF I N +RW V F F KT+ + LFST+ +N Y Sbjct: 248 SIKLFETICN--------SRWFVQAAMILFLNKRDLFEQKLKTTSINVLFSTYQGSNDYA 299 Query: 63 S*ETFVQASVKSVAKITNL 7 ++Q + + K +++ Sbjct: 300 ECVAYIQMRFERLNKYSDI 318
>sp|Q9RH41|RPOB_RICCN DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1373 Score = 28.9 bits (63), Expect = 3.8 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = +2 Query: 164 KQTKTIHLFMGPETFKKFVIGLKRLNVNHRVIIRNEAEVFFC*KSIMKGFH 316 K+ K H+ G E KKF+I L N+N ++ R E E+ K + KG H Sbjct: 1163 KEYKNKHI--GIEQIKKFLIELYGENIN-SILERPEEEIISFCKKVSKGVH 1210
>sp|Q9RH43|RPOB_RICMA DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1373 Score = 28.9 bits (63), Expect = 3.8 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = +2 Query: 164 KQTKTIHLFMGPETFKKFVIGLKRLNVNHRVIIRNEAEVFFC*KSIMKGFH 316 K+ K H+ G E KKF+I L N+N ++ R E E+ K + KG H Sbjct: 1163 KEYKNKHI--GIEQIKKFLIELYGENIN-SILERPEEEIISFCKKVSKGVH 1210
>sp|Q61DE0|GPA15_CAEBR Guanine nucleotide-binding protein alpha-15 subunit Length = 356 Score = 28.5 bits (62), Expect = 5.0 Identities = 19/79 (24%), Positives = 32/79 (40%) Frame = -1 Query: 243 TLSLFNPITNFLNVSGPINRWIVLVCFDTFNTFIKYFADNFKTSIASFLFSTFTSTNLYP 64 ++ LF I N +RW V F F KT+ + LFST+ +N Y Sbjct: 248 SIKLFETICN--------SRWFVQAAMILFLNKRDLFEQKLKTTSINVLFSTYLGSNDYA 299 Query: 63 S*ETFVQASVKSVAKITNL 7 ++Q + + K ++ Sbjct: 300 ECVAYIQLRFERLNKYADV 318
>sp|Q81GK4|CLS2_BACCR Cardiolipin synthetase 2 (Cardiolipin synthase 2) (CL synthase 2) Length = 514 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +2 Query: 143 INVLKVSKQTKTIHLFMGPETFKKFVIGLKR 235 + L +S QT+T L G ETF+ + GLKR Sbjct: 142 LGALNISFQTETRTLTNGDETFRAILNGLKR 172
>sp|Q81TR2|CLS2_BACAN Cardiolipin synthetase 2 (Cardiolipin synthase 2) (CL synthase 2) Length = 514 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +2 Query: 143 INVLKVSKQTKTIHLFMGPETFKKFVIGLKR 235 + L +S QT+T L G ETF+ + GLKR Sbjct: 142 LGALNISFQTETRTLTNGDETFQAILDGLKR 172
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,646,690 Number of Sequences: 369166 Number of extensions: 402136 Number of successful extensions: 1008 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 997 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1008 length of database: 68,354,980 effective HSP length: 84 effective length of database: 52,837,240 effective search space used: 1690791680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)