Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_03053 (144 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q07468|VPS39_YEAST Vacuolar assembly protein VPS39 (Vacu... 28 4.9 sp|Q859W7|YCF2_ANTFO Protein ycf2 28 8.4
>sp|Q07468|VPS39_YEAST Vacuolar assembly protein VPS39 (Vacuolar morphogenesis protein VAM6) Length = 1049 Score = 28.5 bits (62), Expect = 4.9 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 11 LQTTYTPTTLFLNVHPDKKKDLPPLIFLYGKRACFSY-N*KIYIY 142 L +T T LN H D K++ IF Y +AC S + K+Y Y Sbjct: 704 LDVIFTYTDWLLNRHNDSIKEILSSIFFYDSQACSSRDHLKVYGY 748
>sp|Q859W7|YCF2_ANTFO Protein ycf2 Length = 2392 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 10 TTNNIHTHDLVFECPSRQKE-RPPPTYFFVWEASLFFLQLKN 132 T +NIH++DL +++KE + +Y F+ + S FFL +N Sbjct: 527 TESNIHSYDLSSLTKAKRKEVKSGSSYEFLEKDSFFFLMKEN 568
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,040,842 Number of Sequences: 369166 Number of extensions: 305266 Number of successful extensions: 849 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 68,354,980 effective HSP length: 21 effective length of database: 64,475,545 effective search space used: 1676364170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)