Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02895 (252 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8NGH3|OR2D3_HUMAN Olfactory receptor 2D3 30 1.7 sp|Q6E3D0|CBP1_CAEBR Cytoplasmic polyadenylation element bi... 28 8.5
>sp|Q8NGH3|OR2D3_HUMAN Olfactory receptor 2D3 Length = 314 Score = 30.0 bits (66), Expect = 1.7 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 6/67 (8%) Frame = +3 Query: 6 ITLYFCKISALFPVLSV*SFDVIKCLFSNGKYL------IILGTKTHR*ATLIKQQPRMG 167 I YFC+ AL + S+ ++ +FS G + +ILG+ + +T+I+ Q G Sbjct: 174 INHYFCEPPALLKLASIDTYSTEMAIFSMGVVILLAPVSLILGSYWNIISTVIQMQSGEG 233 Query: 168 QLDYFSS 188 +L FS+ Sbjct: 234 RLKAFST 240
>sp|Q6E3D0|CBP1_CAEBR Cytoplasmic polyadenylation element binding protein 1 Length = 585 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +3 Query: 78 CLFSNGKYLIILGTKTHR*ATLIKQQPRMGQLDYFSSYKI 197 C F +GKY + L + T + + + R+ +DYFS K+ Sbjct: 328 CEFYDGKYYLQLSSPTMQDKAVQVRPWRLSDIDYFSEEKV 367
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,246,250 Number of Sequences: 369166 Number of extensions: 384552 Number of successful extensions: 754 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 754 length of database: 68,354,980 effective HSP length: 54 effective length of database: 58,379,290 effective search space used: 1692999410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)