Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02677 (242 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q03701|CEBPZ_HUMAN CCAAT/enhancer binding protein zeta (... 30 2.3 sp|P31916|MAT2_EUGGR Maturase-like protein 2 28 6.6 sp|Q5E951|TBCB_BOVIN Tubulin-specific chaperone B (Tubulin ... 28 8.6
>sp|Q03701|CEBPZ_HUMAN CCAAT/enhancer binding protein zeta (CCAAT-box-binding transcription factor) (CCAAT-binding factor) (CBF) Length = 998 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/51 (25%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +2 Query: 101 DEKHLESHRTNKFTKYSDIDK----IEEFEISEKIPDADVHKVYPELFSYL 241 +E ++++ K++D DK +++ E E +P+ DV PE+ S++ Sbjct: 632 EENFIDANDDEDMEKFTDADKETEIVKKLETEETVPETDVETKKPEVASWV 682
>sp|P31916|MAT2_EUGGR Maturase-like protein 2 Length = 758 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 134 YLFGEIQDVFHQLLVNIRLNILYASIED 51 + F EI +F+ LVNI N++Y SIE+ Sbjct: 222 FFFVEIDKMFNLNLVNISSNLIYNSIEN 249
>sp|Q5E951|TBCB_BOVIN Tubulin-specific chaperone B (Tubulin folding cofactor B) (Cytoskeleton associated protein 1) (Cytoskeleton-associated protein CKAPI) Length = 244 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +2 Query: 110 HLESHRTNKFTKYSDIDKIEEFEISEK 190 H+ H + +Y DI K+E++EIS++ Sbjct: 86 HVIDHSGARLGEYEDISKVEKYEISQE 112
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,169,076 Number of Sequences: 369166 Number of extensions: 262921 Number of successful extensions: 774 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 68,354,980 effective HSP length: 51 effective length of database: 58,933,495 effective search space used: 1709071355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)