Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02620 (267 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P24524|GLRA3_RAT Glycine receptor alpha-3 chain precursor 29 3.0 sp|O75311|GLRA3_HUMAN Glycine receptor alpha-3 chain precursor 29 3.0 sp|Q91XP5|GLRA3_MOUSE Glycine receptor alpha-3 chain precursor 29 3.0 sp|P28473|GBRG3_RAT Gamma-aminobutyric-acid receptor gamma-... 28 6.7 sp|P27681|GBRG3_MOUSE Gamma-aminobutyric-acid receptor gamm... 28 6.7 sp|Q99928|GBRG3_HUMAN Gamma-aminobutyric-acid receptor gamm... 28 6.7 sp|P34904|GBRG4_CHICK Gamma-aminobutyric-acid receptor gamm... 28 8.7
>sp|P24524|GLRA3_RAT Glycine receptor alpha-3 chain precursor Length = 464 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -1 Query: 159 IFVKICFLNIFGAPVDYRTRNFTF--HRLISNFLRKHNQKNH*FSVSFF 19 I++ +C L +F A ++Y NF H+ + F RK K F++ F Sbjct: 318 IWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEAFALEKF 366
>sp|O75311|GLRA3_HUMAN Glycine receptor alpha-3 chain precursor Length = 465 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -1 Query: 159 IFVKICFLNIFGAPVDYRTRNFTF--HRLISNFLRKHNQKNH*FSVSFF 19 I++ +C L +F A ++Y NF H+ + F RK K F++ F Sbjct: 318 IWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEAFALEKF 366
>sp|Q91XP5|GLRA3_MOUSE Glycine receptor alpha-3 chain precursor Length = 464 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -1 Query: 159 IFVKICFLNIFGAPVDYRTRNFTF--HRLISNFLRKHNQKNH*FSVSFF 19 I++ +C L +F A ++Y NF H+ + F RK K F++ F Sbjct: 318 IWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEAFALEKF 366
>sp|P28473|GBRG3_RAT Gamma-aminobutyric-acid receptor gamma-3 subunit precursor (GABA(A) receptor) Length = 467 Score = 28.1 bits (61), Expect = 6.7 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 159 IFVKICFLNIFGAPVDYRTRNF 94 +FV +CFL +F A ++Y T N+ Sbjct: 318 LFVTVCFLFVFAALMEYATLNY 339
>sp|P27681|GBRG3_MOUSE Gamma-aminobutyric-acid receptor gamma-3 subunit precursor (GABA(A) receptor) Length = 467 Score = 28.1 bits (61), Expect = 6.7 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 159 IFVKICFLNIFGAPVDYRTRNF 94 +FV +CFL +F A ++Y T N+ Sbjct: 318 LFVTVCFLFVFAALMEYATLNY 339
>sp|Q99928|GBRG3_HUMAN Gamma-aminobutyric-acid receptor gamma-3 subunit precursor (GABA(A) receptor) Length = 467 Score = 28.1 bits (61), Expect = 6.7 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 159 IFVKICFLNIFGAPVDYRTRNF 94 +FV +CFL +F A ++Y T N+ Sbjct: 318 LFVTVCFLFVFAALMEYATLNY 339
>sp|P34904|GBRG4_CHICK Gamma-aminobutyric-acid receptor gamma-4 subunit precursor (GABA(A) receptor) Length = 457 Score = 27.7 bits (60), Expect = 8.7 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -1 Query: 159 IFVKICFLNIFGAPVDYRTRNF 94 +FV +CF+ +F A ++Y T N+ Sbjct: 320 LFVSVCFIFVFAALMEYATLNY 341
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,656,499 Number of Sequences: 369166 Number of extensions: 467394 Number of successful extensions: 888 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 68,354,980 effective HSP length: 58 effective length of database: 57,640,350 effective search space used: 1729210500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)