Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02618 (413 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P39683|NPT1_YEAST Nicotinate phosphoribosyltransferase (... 29 4.3 sp|Q9MTQ1|MATK_OENHO Maturase K (Intron maturase) 28 5.6
>sp|P39683|NPT1_YEAST Nicotinate phosphoribosyltransferase (NAPRTase) Length = 429 Score = 28.9 bits (63), Expect = 4.3 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = -3 Query: 399 KTFPEAPSQHRN*PIMLKLVEVAGNEIISLSDN 301 K+ P+ S+ N I++KL+EV GN I +SDN Sbjct: 364 KSEPQVKSEPLN--IVIKLLEVNGNHAIKISDN 394
>sp|Q9MTQ1|MATK_OENHO Maturase K (Intron maturase) Length = 512 Score = 28.5 bits (62), Expect = 5.6 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 168 GDANINHLKD*NINFKNYSINIQIQSHQQTNNC*ETTYFIN 46 G NIN L +++F Y N+Q++S N E ++ IN Sbjct: 319 GRININQLGKYSLDFLGYFSNVQLKSSVVRNQTLENSFLIN 359
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,477,783 Number of Sequences: 369166 Number of extensions: 580645 Number of successful extensions: 795 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 791 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 68,354,980 effective HSP length: 99 effective length of database: 50,066,215 effective search space used: 1902516170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)