Planaria EST Database


DrC_02409

BLASTX 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_02409
         (765 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q85X54|RPOB_PINKO  DNA-directed RNA polymerase beta chain...    30   7.2  
>sp|Q85X54|RPOB_PINKO DNA-directed RNA polymerase beta chain (PEP) (Plastid-encoded RNA
           polymerase beta subunit) (RNA polymerase beta subunit)
          Length = 1075

 Score = 30.0 bits (66), Expect = 7.2
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = +2

Query: 584 IHHLNDHALEMLDGEDGQSLQCMWRRTHDILNNK-QDQNTTESVC 715
           I HL+ H+L  LD E+G  +   W  T D+L  K   Q T ES+C
Sbjct: 714 IPHLDAHSLRHLD-ENGLVMLGSWIETGDVLVGKLTPQTTEESLC 757
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 68,567,871
Number of Sequences: 369166
Number of extensions: 1169212
Number of successful extensions: 2435
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2278
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2435
length of database: 68,354,980
effective HSP length: 108
effective length of database: 48,403,600
effective search space used: 7066925600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)