• TOP
• EST
• Cluster

Planaria EST Database

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_02379
         (756 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9BBS7|RPOC2_LOTJA  DNA-directed RNA polymerase beta'' ch...    30   7.0  

>sp|Q9BBS7|RPOC2_LOTJA DNA-directed RNA polymerase beta'' chain (PEP) (Plastid-encoded RNA
            polymerase beta'' subunit) (RNA polymerase beta''
            subunit)
          Length = 1332

 Score = 30.0 bits (66), Expect = 7.0
 Identities = 14/59 (23%), Positives = 27/59 (45%)
 Frame = -3

Query: 577  FNLVFFRGWTSDSFNA*KQNKSFPNKFHFTEFSLLNTLANLLNYFI*FSYNKLKSLDQN 401
            FN V +     +  N  K+N   P K       +   +AN  +++   ++NK+ S+ +N
Sbjct: 927  FNNVKYHNGIKEEINQFKRNHKIPIKISLGPLGVAPQIANFFSFYHLITHNKISSIKKN 985

  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 68,167,870
Number of Sequences: 369166
Number of extensions: 1125554
Number of successful extensions: 2462
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2426
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2461
length of database: 68,354,980
effective HSP length: 108
effective length of database: 48,403,600
effective search space used: 6921714800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)