Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02252 (910 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q33568|CYB_TRYBO Cytochrome b 36 0.17 sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 31 4.2
>sp|Q33568|CYB_TRYBO Cytochrome b Length = 372 Score = 35.8 bits (81), Expect = 0.17 Identities = 20/71 (28%), Positives = 35/71 (49%) Frame = -2 Query: 267 IRFLFGLCMDQYFLDILISQRFAN**IYYLIVHIHFDLVYNDRFLHRVLNRSPLL*EY*H 88 ++ L G+C+ +F +I Q + I+ L++H+ FDL + R LH + Y H Sbjct: 42 LQILVGICLSWFFFRCIIPQNW----IFTLLIHLEFDLGFIIRSLHIIFTSLLYFLLYIH 97 Query: 87 SVLSLNLCKHF 55 + + LC F Sbjct: 98 IIKVIFLCLIF 108
>sp|Q9HF75|BEM2_ASHGO GTPase-activating protein BEM2 Length = 2071 Score = 31.2 bits (69), Expect = 4.2 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = -2 Query: 690 PSNRTVPKSQTASFLQYRSVNNCNHSVAGNSWCVS--YSVDNIDIRIPVEY*KKIS 529 PS + SQ ++ + SVN+ HS A +S S +DNID+ I E K+S Sbjct: 787 PSTKNNNSSQASNRISQLSVNSTPHSNASSSSAASAVTGIDNIDVPITKEISSKLS 842
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,154,866 Number of Sequences: 369166 Number of extensions: 1830806 Number of successful extensions: 4599 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4596 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 9222552960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)