Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02169 (382 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P58151|YCXC_ASTLO Hypothetical 51.9 kDa protein in rps4-... 33 0.20 sp|P62367|SYH1_BACC1 Histidyl-tRNA synthetase 1 (Histidine-... 29 3.8 sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 29 3.8 sp|P13612|ITA4_HUMAN Integrin alpha-4 precursor (Integrin a... 28 6.5 sp|Q60301|YY02_METJA Hypothetical adenine-specific methylas... 28 8.5 sp|Q8DC96|ICIA_VIBVU Chromosome initiation inhibitor (OriC ... 28 8.5 sp|Q8M355|RMAR_SACCA Mitochondrial ribosomal protein VAR1 28 8.5 sp|Q7MHL5|ICIA_VIBVY Chromosome initiation inhibitor (OriC ... 28 8.5
>sp|P58151|YCXC_ASTLO Hypothetical 51.9 kDa protein in rps4-rps11 intergenic region (ORF426) Length = 426 Score = 33.1 bits (74), Expect = 0.20 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = -3 Query: 164 DS*YFLKFCYYIGHSWINSSQ*NRPILICQFNSNRYPYFSYFCADHFIY 18 D +F+ Y +I+ S+ NRP I + SN P+FSY + FIY Sbjct: 341 DRPFFIDRSKYNKPFFIDKSKYNRPFFIDKSKSNNIPFFSYQKKEPFIY 389
>sp|P62367|SYH1_BACC1 Histidyl-tRNA synthetase 1 (Histidine--tRNA ligase 1) (HisRS 1) Length = 436 Score = 28.9 bits (63), Expect = 3.8 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = +2 Query: 98 FTVMNLSKNVQYNN-KILKNIMNQFNI--QRFPN*IIKLGNIYFINFFQISRDFI 253 F +NL +QYNN K+L I+ NI +R + I+ L I I + +D + Sbjct: 148 FRTLNLEVTIQYNNRKLLNGILESINIPTERTSDVILSLDKIEKIGIDGVRKDVL 202
>sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 Length = 1038 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 2/34 (5%) Frame = +1 Query: 142 NFKKYYESV*--YSEISKLNN*VRQYLLYQFFSN 237 +F+K+Y+++ S+IS+ NN ++QYL FF N Sbjct: 753 DFQKFYKNIAENLSDISEENNNMKQYLKNHFFKN 786
>sp|P13612|ITA4_HUMAN Integrin alpha-4 precursor (Integrin alpha-IV) (VLA-4) (CD49d) Length = 1038 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -1 Query: 112 IHHSKTDRY*SVNLIQIDIHIFLIFVLIISYI 17 +HH + RY ++ +I + + LI +L+ISY+ Sbjct: 973 LHHQRPKRYFTIVIISSSLLLGLIVLLLISYV 1004
>sp|Q60301|YY02_METJA Hypothetical adenine-specific methylase MJECS02 Length = 1181 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -1 Query: 259 VCNEISGYLKKIDKVNIA*LNY--SVWKSLN 173 +CNEI+G +KK D+ +I L Y ++ K LN Sbjct: 1136 ICNEINGIIKKYDEKSIDCLKYCQNIIKLLN 1166
>sp|Q8DC96|ICIA_VIBVU Chromosome initiation inhibitor (OriC replication inhibitor) Length = 298 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 203 LGNIYFINFFQISRDFITNHSVGS 274 L N + + F ISRD I NH+VGS Sbjct: 202 LHNRFLHDHFNISRDSIINHNVGS 225
>sp|Q8M355|RMAR_SACCA Mitochondrial ribosomal protein VAR1 Length = 326 Score = 27.7 bits (60), Expect = 8.5 Identities = 19/81 (23%), Positives = 39/81 (48%) Frame = +2 Query: 26 NDQHKNKKNMDIYLN*IDRLISVGFTVMNLSKNVQYNNKILKNIMNQFNIQRFPN*IIKL 205 N + N K M+ L I+ + + + N +KN + N ++ N+MN+ + KL Sbjct: 34 NTNNNNMKYMNNKLQSINNMNNWSLQMYNYNKNNELNMMMMMNMMNKL--------LYKL 85 Query: 206 GNIYFINFFQISRDFITNHSV 268 N+ IN ++ + N+++ Sbjct: 86 MNMIMINNMTMNVNNKNNNNI 106
>sp|Q7MHL5|ICIA_VIBVY Chromosome initiation inhibitor (OriC replication inhibitor) Length = 298 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 203 LGNIYFINFFQISRDFITNHSVGS 274 L N + + F ISRD I NH+VGS Sbjct: 202 LHNRFLHDHFNISRDSIINHNVGS 225
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,540,095 Number of Sequences: 369166 Number of extensions: 484942 Number of successful extensions: 849 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 68,354,980 effective HSP length: 93 effective length of database: 51,174,625 effective search space used: 1688762625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)