Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01966 (830 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O86236|YD2A_HAEIN Hypothetical transposase-like protein ... 53 1e-06 sp|O74421|COQ3_SCHPO Hexaprenyldihydroxybenzoate methyltran... 32 1.6
>sp|O86236|YD2A_HAEIN Hypothetical transposase-like protein HI1328.1 Length = 123 Score = 52.8 bits (125), Expect = 1e-06 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 1/105 (0%) Frame = +3 Query: 444 KVFFAEINDRSAMTLIEIITKYVRPGSIIYTDMWKGYCNFAREGFSHETVNHSISFKDID 623 KV+ + + + TL+ II + V+P SI+YTD ++ Y FSH +NHS F + Sbjct: 4 KVYTVVVPNVQSATLLPIIREKVKPDSIVYTDTFRSYDVLDVSEFSHFRINHSTHFAENH 63 Query: 624 TGVHTNTIEGTWNGLKLLIKPRNR-TKENIEEHLWEFIWRKLNHQ 755 + N I WN K ++ N KE+ E +L E WR N + Sbjct: 64 N--YINGIGNFWNHAKRHLQKFNGIPKEHFELYLKECEWRFNNSE 106
>sp|O74421|COQ3_SCHPO Hexaprenyldihydroxybenzoate methyltransferase, mitochondrial precursor (Dihydroxyhexaprenylbenzoate methyltransferase) (3,4-dihydroxy-5-hexaprenylbenzoate methyltransferase) (DHHB methyltransferase) (DHHB-MT) (DHHB-MTase) Length = 271 Score = 32.3 bits (72), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 546 KGYCNFAREGFSHETVNHSISFKDIDTGVHTNTIEGTW 659 K Y R+GF + NHS+S ++D H N + TW Sbjct: 11 KSYTRLVRQGFLSQQRNHSVSVNEVD---HFNELAKTW 45
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,879,998 Number of Sequences: 369166 Number of extensions: 1744845 Number of successful extensions: 3749 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3749 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 8052550455 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)