Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01911 (261 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O61303|OPSUV_APIME Opsin, ultraviolet-sensitive (AMUVOP)... 31 0.76 sp|P28466|WNT5_DROME Wnt-5 protein precursor (dWnt-5) (dWnt-3) 29 3.8
>sp|O61303|OPSUV_APIME Opsin, ultraviolet-sensitive (AMUVOP) (BUVOPS) Length = 371 Score = 31.2 bits (69), Expect = 0.76 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +3 Query: 39 GYLHSIL*SYIKFTGEIRIFFAKVM---FCAPMLFVLQY 146 G+L S Y+ T EIRIF A + +C PM+ ++ Y Sbjct: 192 GFLTSCSFDYLTDTNEIRIFVATIFTFSYCIPMILIIYY 230
>sp|P28466|WNT5_DROME Wnt-5 protein precursor (dWnt-5) (dWnt-3) Length = 1004 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 152 SNILQYKKHWSTKHYFCKKNSNFASKF 72 SNI KKH H K NSNF SKF Sbjct: 205 SNIDDLKKHILFLHNMTKTNSNFESKF 231
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,568,156 Number of Sequences: 369166 Number of extensions: 411227 Number of successful extensions: 723 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 68,354,980 effective HSP length: 57 effective length of database: 57,825,085 effective search space used: 1676927465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)