Planaria EST Database


DrC_01865

BLASTX 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_01865
         (277 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|O67568|RL5_AQUAE  50S ribosomal protein L5                      28   8.6  
>sp|O67568|RL5_AQUAE 50S ribosomal protein L5
          Length = 188

 Score = 27.7 bits (60), Expect = 8.6
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +2

Query: 2   CKFTEEKAYLWNY*YKTVYVGLPLPK--RGMKPKEF 103
           CK T  K  +W++  K + V LP  K  +G+ P+ F
Sbjct: 95  CKVTLRKERMWDFLDKLISVALPRVKDFKGLSPRSF 130
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 32,085,225
Number of Sequences: 369166
Number of extensions: 523874
Number of successful extensions: 1035
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1028
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1035
length of database: 68,354,980
effective HSP length: 61
effective length of database: 57,086,145
effective search space used: 1712584350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)