Planaria EST Database


DrC_01858

BLASTX 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_01858
         (231 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9Y5S8|NOX1_HUMAN  NADPH oxidase homolog 1 (NOX-1) (NOH-1...    28   6.7  
>sp|Q9Y5S8|NOX1_HUMAN NADPH oxidase homolog 1 (NOX-1) (NOH-1) (NADH/NADPH mitogenic
           oxidase subunit P65-MOX) (Mitogenic oxidase 1) (MOX1)
          Length = 564

 Score = 28.1 bits (61), Expect = 6.7
 Identities = 8/33 (24%), Positives = 22/33 (66%)
 Frame = +2

Query: 29  ISHWIISVYF*IMFHVLYVALNYRYYISILIKY 127
           + +W+++ +F ++F V+++ LN   ++   +KY
Sbjct: 1   MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKY 33
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,075,907
Number of Sequences: 369166
Number of extensions: 331092
Number of successful extensions: 752
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 744
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 752
length of database: 68,354,980
effective HSP length: 47
effective length of database: 59,672,435
effective search space used: 1730500615
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)