DrC_01659
- Cluster detail : Singlet (Dr_sW_008_F02)
- GO Category :
Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= DrC_01659
(865 letters)
Database: Non-redundant SwissProt sequences
184,735 sequences; 68,354,980 total letters
Score E
Sequences producing significant alignments: (bits) Value
sp|Q8E9N7|GLPK_SHEON Glycerol kinase (ATP:glycerol 3-phosph... 30 8.7
>sp|Q8E9N7|GLPK_SHEON Glycerol kinase (ATP:glycerol 3-phosphotransferase) (Glycerokinase)
(GK)
Length = 494
Score = 30.0 bits (66), Expect = 8.7
Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
Frame = +1
Query: 34 IIRLSMCR*VSLKSDLINSVS*HIWNTLSELPKQVKID-YFFDSLNIDY 177
++R S+C +L + + ++ WN+++EL + ID +F S+N DY
Sbjct: 429 VLRPSVCETTALGAAFLAGLAVGFWNSVTELEHKACIDTHFKPSINADY 477
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 81,696,413
Number of Sequences: 369166
Number of extensions: 1407223
Number of successful extensions: 2895
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2833
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2895
length of database: 68,354,980
effective HSP length: 109
effective length of database: 48,218,865
effective search space used: 8582957970
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)