Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01580 (287 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P31713|ISH1_STOHE Kunitz-type proteinase inhibitor SHPI-1 79 4e-15 sp|P81129|ISH2_STOHE Kunitz-type proteinase inhibitor SHPI-2 77 1e-14 sp|P24541|IVBIT_ERIMA Venom trypsin inhibitor 72 5e-13 sp|P10280|IP52_ANESU Kunitz-type protease inhibitor 5 II (S... 71 7e-13 sp|P00992|IVBI3_VIPAA Venom basic protease inhibitor III (V... 70 1e-12 sp|Q9DA01|EPPI_MOUSE Eppin precursor (Epididymal protease i... 70 1e-12 sp|Q9TWF8|KC3_ANESU Kunitz-type kalicludine 3 (AsKC3) 69 3e-12 sp|P00993|IBP_CARCR Chelonianin (Basic protease inhibitor) ... 69 4e-12 sp|P81547|AXP1_ANTAF Kunitz-type proteinase inhibitor AXPI-I 68 7e-12 sp|Q28201|TKDP1_BOVIN Trophoblast Kunitz domain protein 1 p... 67 1e-11
>sp|P31713|ISH1_STOHE Kunitz-type proteinase inhibitor SHPI-1 Length = 55 Score = 78.6 bits (192), Expect = 4e-15 Identities = 31/54 (57%), Positives = 40/54 (74%) Frame = +2 Query: 44 SQCNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFATEGECQKVCK 205 S C+EPK+ G C Y PRF+F+S G+C FIYGGCGGNGNNF T +C+ +C+ Sbjct: 1 SICSEPKKVGRCKGYFPRFYFDSETGKCTPFIYGGCGGNGNNFETLHQCRAICR 54
>sp|P81129|ISH2_STOHE Kunitz-type proteinase inhibitor SHPI-2 Length = 55 Score = 77.0 bits (188), Expect = 1e-14 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = +2 Query: 44 SQCNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFATEGECQKVCK 205 S C EPK+ G C Y PRF+F+S G+C FIYGGCGGNGNNF T +C+ +C+ Sbjct: 1 SFCLEPKRVGRCKGYFPRFYFDSKTGKCTPFIYGGCGGNGNNFETLHQCRAICR 54
>sp|P24541|IVBIT_ERIMA Venom trypsin inhibitor Length = 62 Score = 71.6 bits (174), Expect = 5e-13 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = +2 Query: 50 CNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFATEGECQKVC 202 C P G+C A+IPRF++N +C++FIYGGCGGN NNF T EC+ C Sbjct: 2 CYLPDDPGVCKAHIPRFYYNPASNKCKNFIYGGCGGNANNFETRAECRHTC 52
>sp|P10280|IP52_ANESU Kunitz-type protease inhibitor 5 II (SA5 II) Length = 62 Score = 71.2 bits (173), Expect = 7e-13 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +2 Query: 50 CNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFATEGECQKVC 202 C PK G C A PR+++NS CE FIYGGCGGN NNF T EC+KVC Sbjct: 5 CELPKVVGPCRARFPRYYYNSSSKRCEKFIYGGCGGNANNFHTLEECEKVC 55
>sp|P00992|IVBI3_VIPAA Venom basic protease inhibitor III (Venom chymotrypsin inhibitor) Length = 65 Score = 70.5 bits (171), Expect = 1e-12 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = +2 Query: 50 CNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFATEGECQKVC 202 C P G CLAY+PRF++N +CE FIYGGC GN NNF T EC+ C Sbjct: 7 CYLPADPGRCLAYMPRFYYNPASNKCEKFIYGGCRGNANNFKTWDECRHTC 57
>sp|Q9DA01|EPPI_MOUSE Eppin precursor (Epididymal protease inhibitor) (Serine protease inhibitor-like with Kunitz and WAP domains 1) Length = 134 Score = 70.1 bits (170), Expect = 1e-12 Identities = 30/71 (42%), Positives = 41/71 (57%), Gaps = 4/71 (5%) Frame = +2 Query: 11 CAIFNLGES----KASQCNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFAT 178 C +FN G+ + C+ PK G C+AY R++FN C+ FIYGGC GN NNF + Sbjct: 60 CCVFNCGKKCLNPQQDICSLPKDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQS 119 Query: 179 EGECQKVCK*K 211 + CQ C+ K Sbjct: 120 QSICQNACEKK 130
>sp|Q9TWF8|KC3_ANESU Kunitz-type kalicludine 3 (AsKC3) Length = 59 Score = 69.3 bits (168), Expect = 3e-12 Identities = 29/51 (56%), Positives = 33/51 (64%) Frame = +2 Query: 50 CNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFATEGECQKVC 202 C PK G C A PR+++N CE FIYGGCGGN NNF T EC+KVC Sbjct: 5 CELPKVVGRCRARFPRYYYNLSSRRCEKFIYGGCGGNANNFHTLEECEKVC 55
>sp|P00993|IBP_CARCR Chelonianin (Basic protease inhibitor) (RTPI) Length = 110 Score = 68.6 bits (166), Expect = 4e-12 Identities = 28/56 (50%), Positives = 35/56 (62%) Frame = +2 Query: 38 KASQCNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFATEGECQKVCK 205 K C P ++G C IPR+F+N CESFIYGGC GN NNF T+ EC + C+ Sbjct: 4 KRDICRLPPEQGPCKGRIPRYFYNPASRMCESFIYGGCKGNKNNFKTKAECVRACR 59
>sp|P81547|AXP1_ANTAF Kunitz-type proteinase inhibitor AXPI-I Length = 58 Score = 67.8 bits (164), Expect = 7e-12 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +2 Query: 50 CNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFATEGECQKVC 202 C PK+ G C A +PRF++NS G+CE F YGGC N NNF T+ EC+ C Sbjct: 7 CLLPKKVGPCRAAVPRFYYNSDSGKCEGFTYGGCHANANNFKTKDECKNAC 57
>sp|Q28201|TKDP1_BOVIN Trophoblast Kunitz domain protein 1 precursor (TKDP-1) Length = 351 Score = 67.4 bits (163), Expect = 1e-11 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = +2 Query: 23 NLGESKASQCNEPKQRGMCLAYIPRFFFNSVKGECESFIYGGCGGNGNNFATEGECQKVC 202 N SK + C EPK G C A + R+F+N+ G CE F+Y GC GNGNNF +C K C Sbjct: 285 NKAASKPALCLEPKVTGGCNAVMTRYFYNAQNGLCEQFVYDGCEGNGNNFEKLEDCMKTC 344
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,147,245 Number of Sequences: 369166 Number of extensions: 577796 Number of successful extensions: 1523 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1520 length of database: 68,354,980 effective HSP length: 65 effective length of database: 56,347,205 effective search space used: 1690416150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)