DrC_01550
	
		- Cluster detail : Singlet (Dr_sW_006_M07)
 
		- GO Category :
Not Available
		
 
		- Consensus Sequence : 
 
	
	
	
	BLASTX 2.2.13 [Nov-27-2005]
	
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= DrC_01550
         (243 letters)
Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
sp|P16733|VGLM_HCMVA  Glycoprotein M                               32   0.46 
>sp|P16733|VGLM_HCMVA Glycoprotein M
          Length = 372
 Score = 32.0 bits (71), Expect = 0.46
 Identities = 15/43 (34%), Positives = 24/43 (55%)
 Frame = +1
Query: 85  GNNLKCLFL*RSYMILETFLLYTIIDLIYFVNFALYLFTFFKI 213
           GNN    F+   +M+L  F++Y II +IYF+      F + K+
Sbjct: 226 GNNF---FVRTGHMVLAVFVVYAIISIIYFLLIEAVFFQYVKV 265
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,682,820
Number of Sequences: 369166
Number of extensions: 233956
Number of successful extensions: 350
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 346
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 350
length of database: 68,354,980
effective HSP length: 51
effective length of database: 58,933,495
effective search space used: 1709071355
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)