Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01538 (662 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P49466|RPOB_ODOSI DNA-directed RNA polymerase beta chain... 29 9.6 sp|Q8KCG4|PROB_CHLTE Glutamate 5-kinase (Gamma-glutamyl kin... 29 9.6
>sp|P49466|RPOB_ODOSI DNA-directed RNA polymerase beta chain (PEP) (Plastid-encoded RNA polymerase beta subunit) (RNA polymerase beta subunit) Length = 1379 Score = 29.3 bits (64), Expect = 9.6 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = -3 Query: 285 YEVVSYNVFEKISYKLSNQTKQLALQVFHQWI*ILPESFHFFSK 154 Y + S+ +++KIS ++ K +++F QW+ + + F+F +K Sbjct: 198 YSLKSFKIYQKISKITNSPIKVQRIKLFLQWLKLNQKEFNFKNK 241
>sp|Q8KCG4|PROB_CHLTE Glutamate 5-kinase (Gamma-glutamyl kinase) (GK) Length = 361 Score = 29.3 bits (64), Expect = 9.6 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -2 Query: 295 YLGLRSCFL*RLRKNIL*TLQSNEAIGITGFSSMDLDS-SGILSFFFKKFAFNLLIS 128 YL +R+CF L++ I+ + N+A+ IT D D SG+++ + A N+++S Sbjct: 118 YLNMRTCFEALLQQKIVPIVNENDAVAITELMFTDNDELSGLIASMLQVDA-NIILS 173
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,877,129 Number of Sequences: 369166 Number of extensions: 954470 Number of successful extensions: 2258 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2257 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5560129980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)