• TOP
• EST
• Cluster

Planaria EST Database

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_01362
         (251 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q93008|USP9X_HUMAN  Probable ubiquitin carboxyl-terminal ...    28   8.5  

>sp|Q93008|USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X (Ubiquitin
            thiolesterase FAF-X) (Ubiquitin specific-processing
            protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat
            facets protein related, X-linked) (Ubiquitin-specific
            protease 9, X chromosome)
          Length = 2547

 Score = 27.7 bits (60), Expect = 8.5
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 2/30 (6%)
 Frame = -3

Query: 207  FDTLASSKNHH--RCRQLLRCQTSLTNHLP 124
            FDT+  SKNH+  R  Q ++C  +L ++ P
Sbjct: 2363 FDTIQRSKNHYQKRAYQCIKCMVALFSNCP 2392

  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,191,249
Number of Sequences: 369166
Number of extensions: 240546
Number of successful extensions: 638
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 633
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 638
length of database: 68,354,980
effective HSP length: 54
effective length of database: 58,379,290
effective search space used: 1692999410
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)