Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01316 (649 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8WXS8|ATS14_HUMAN ADAMTS-14 precursor (A disintegrin an... 32 1.1 sp|Q7M878|PANB_WOLSU 3-methyl-2-oxobutanoate hydroxymethylt... 30 5.4
>sp|Q8WXS8|ATS14_HUMAN ADAMTS-14 precursor (A disintegrin and metalloproteinase with thrombospondin motifs 14) (ADAM-TS 14) (ADAM-TS14) Length = 1223 Score = 32.3 bits (72), Expect = 1.1 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +3 Query: 363 ISHNLPINCAICSGWGTRTPPPRIKGYSNMLGIS 464 +S+ LP++CA+C+ G+RTP + G + G++ Sbjct: 8 LSYLLPLHCALCAAAGSRTPELHLSGKLSDYGVT 41
>sp|Q7M878|PANB_WOLSU 3-methyl-2-oxobutanoate hydroxymethyltransferase (Ketopantoate hydroxymethyltransferase) Length = 262 Score = 30.0 bits (66), Expect = 5.4 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 419 AATTHQGVLEYARDIRKGRF 478 A+ QGV EYA+D+R+GRF Sbjct: 236 ASLIRQGVREYAKDVREGRF 255
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,106,468 Number of Sequences: 369166 Number of extensions: 951421 Number of successful extensions: 2248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2241 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5316264630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)