Planaria EST Database


DrC_01240

BLASTX 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_01240
         (458 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q8K9Z9|APAH_BUCAP  Bis(5'-nucleosyl)-tetraphosphatase, sy...    28   7.5  
>sp|Q8K9Z9|APAH_BUCAP Bis(5'-nucleosyl)-tetraphosphatase, symmetrical (Diadenosine
           tetraphosphatase) (Ap4A hydrolase) (Diadenosine
           5',5'''-P1,P4-tetraphosphate pyrophosphohydrolase)
          Length = 273

 Score = 28.5 bits (62), Expect = 7.5
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = -3

Query: 102 NVYQLTTRRYEINVFYHIFICFPWLRINFV 13
           N+ +L   RY INVF  +  C+P  R+N +
Sbjct: 166 NLNKLDRLRYSINVFTRMRYCYPDSRLNLI 195
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,064,702
Number of Sequences: 369166
Number of extensions: 686125
Number of successful extensions: 1385
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1377
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1385
length of database: 68,354,980
effective HSP length: 101
effective length of database: 49,696,745
effective search space used: 2534533995
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)