DrC_01101
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01101 (569 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O75324|SNN_HUMAN Stannin (AG8_1) 29 7.2 sp|P61808|SNN_RAT Stannin >gi|48429134|sp|P61807|SNN_MOUSE ... 29 7.2 sp|Q12933|TRAF2_HUMAN TNF receptor-associated factor 2 (Tum... 29 9.4
>sp|O75324|SNN_HUMAN Stannin (AG8_1) Length = 88 Score = 29.3 bits (64), Expect = 7.2 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +2 Query: 170 CYLYLRIQRLESVQNNNEIIPNRKTNKLFIQMEWS 274 C+ YLR+QR+ ++ I+ + +T + F+ +++S Sbjct: 32 CWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYS 66
>sp|P61808|SNN_RAT Stannin sp|P61807|SNN_MOUSE Stannin Length = 88 Score = 29.3 bits (64), Expect = 7.2 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +2 Query: 170 CYLYLRIQRLESVQNNNEIIPNRKTNKLFIQMEWS 274 C+ YLR+QR+ ++ I+ + +T + F+ +++S Sbjct: 32 CWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYS 66
>sp|Q12933|TRAF2_HUMAN TNF receptor-associated factor 2 (Tumor necrosis factor type 2 receptor-associated protein 3) Length = 501 Score = 28.9 bits (63), Expect = 9.4 Identities = 27/116 (23%), Positives = 45/116 (38%), Gaps = 6/116 (5%) Frame = +3 Query: 15 IKLMTSEWFYDKQNPYKMCLQ------XXXXXXXXXXXXXXCRGAFDSDLRWPCETDIVI 176 I + S FY + YKMCL+ +G D+ LRWP + + Sbjct: 373 IPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTL 432 Query: 177 YIYAFNDWNLSKTITKSYQIEKPTNYSFKWSGPIKISHSDLIESNLNNGCLLFCMV 344 + D N + + ++ +P S + P+ + N+ +GC LFC V Sbjct: 433 MLL---DQNNREHVIDAF---RPDVTSSSFQRPVN-------DMNIASGCPLFCPV 475
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 61,631,739
Number of Sequences: 369166
Number of extensions: 1128715
Number of successful extensions: 2159
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 2121
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2158
length of database: 68,354,980
effective HSP length: 104
effective length of database: 49,142,540
effective search space used: 4177115900
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
