• TOP
• EST
• Cluster

Planaria EST Database

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_00235
         (608 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P41949|YLK1_CAEEL  Hypothetical protein D1044.1 in chromo...    30   4.8  

>sp|P41949|YLK1_CAEEL Hypothetical protein D1044.1 in chromosome III
          Length = 425

 Score = 30.0 bits (66), Expect = 4.8
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 14/55 (25%)
 Frame = -3

Query: 531 LGTQIENHRHHCSRLLENVFST-------------ELEEPW-SHFNFLYQDSLFS 409
           LG  +EN R +  R L + ++T             +LEE + +HFNF+   SLFS
Sbjct: 331 LGLSVENRRANTQRYLNHYYTTFKSHFSTAPFTFSQLEESYRTHFNFVNATSLFS 385

  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 52,949,001
Number of Sequences: 369166
Number of extensions: 857196
Number of successful extensions: 1694
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1642
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1691
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4748907085
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)

Cluster detail

1. Dr_sW_006_M04
2. Dr_sW_009_J08
3. Dr_sW_009_O19
4. Dr_sW_026_I16
5. Dr_sW_007_G01