Planarian EST Database

Dr_sW_028_P18-1

BLASTX 2.2.12 [Aug-07-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Dr_sW_028_P18-1
         (134 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q85ZU4|MATK_HORLE  Maturase K (Intron maturase) >gi|68052...    28   8.5  

>sp|Q85ZU4|MATK_HORLE Maturase K (Intron maturase)
 sp|Q85ZU5|MATK_HORJU Maturase K (Intron maturase)
          Length = 511

 Score = 27.7 bits (60), Expect = 8.5
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 5/43 (11%)
 Frame = -1

Query: 116 IKSIFHFNNEIKEIFQI-----YSWCDVAVMYLRNSNSCLAIS 3
           +KSIF+F  E K +F+       S  +  +++LR  +SCL ++
Sbjct: 198 MKSIFYFQKENKRLFKFLYNSYVSEYEFFLLFLRKQSSCLPLA 240

  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,388,630
Number of Sequences: 369166
Number of extensions: 129345
Number of successful extensions: 331
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 330
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 331
length of database: 68,354,980
effective HSP length: 18
effective length of database: 65,029,750
effective search space used: 1690773500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)