Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_028_N11 (310 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P75072|Y042_MYCPN Hypothetical protein MPN042 (B01_orf672) 30 2.3 sp|Q7G9P4|ALDO3_ARATH Aldehyde oxidase 3 (AtAO-3) (AtAO4) 29 3.0 sp|P38734|MUP3_YEAST Low-affinity methionine permease 28 8.6
>sp|P75072|Y042_MYCPN Hypothetical protein MPN042 (B01_orf672) Length = 672 Score = 29.6 bits (65), Expect = 2.3 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -1 Query: 247 FFLTYTHDGTIVISWEPKTCKNLCTSRAAYYFNSQVQRGFVVPHLVDKLS 98 F +TY+ DG +V SW+ ++ Y FN Q Q+ VPH + K++ Sbjct: 581 FKVTYSFDG-VVPSWK---YGHIQVRTPQYSFNKQEQKILFVPHAIQKIA 626
>sp|Q7G9P4|ALDO3_ARATH Aldehyde oxidase 3 (AtAO-3) (AtAO4) Length = 1332 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/46 (23%), Positives = 26/46 (56%) Frame = -1 Query: 211 ISWEPKTCKNLCTSRAAYYFNSQVQRGFVVPHLVDKLSFTLVLVIE 74 +S++ K CK C SR A +VQ ++ +++ ++ +L + ++ Sbjct: 895 LSFDVKVCKTNCLSRTAMRAPGEVQGSYIAESIIENVASSLQMDVD 940
>sp|P38734|MUP3_YEAST Low-affinity methionine permease Length = 546 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 241 LTYTHDGTIVISWEPKTC 188 +TY HDG IV W K C Sbjct: 527 ITYLHDGLIVTEWVKKPC 544
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,490,447 Number of Sequences: 369166 Number of extensions: 665658 Number of successful extensions: 1402 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1402 length of database: 68,354,980 effective HSP length: 71 effective length of database: 55,238,795 effective search space used: 1712402645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)