Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_028_K08 (457 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q10301|YD48_SCHPO Hypothetical protein C22H10.08 in chro... 30 1.9 sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB 30 2.5 sp|Q6NVD0|FREM2_MOUSE FRAS1-related extracellular matrix pr... 30 3.3 sp|O33815|BGAL_STAXY Beta-galactosidase (Lactase) 29 4.3 sp|O65782|C83B1_ARATH Cytochrome P450 83B1 29 5.6 sp|Q90WJ8|AJL2_ANGJA Lactose-binding lectin l-2 precursor (... 29 5.6
>sp|Q10301|YD48_SCHPO Hypothetical protein C22H10.08 in chromosome I Length = 492 Score = 30.4 bits (67), Expect = 1.9 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 47 GQYIPGKLVEGWNEVFVAYGGAEHSKNYYEVLVESSILNHKG 172 G I G+L WN + H+K+YY VL+ S L+ G Sbjct: 455 GSCIDGRLTSAWN-----WANNIHTKDYYRVLLMSGFLSFNG 491
>sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB Length = 373 Score = 30.0 bits (66), Expect = 2.5 Identities = 20/67 (29%), Positives = 29/67 (43%) Frame = +2 Query: 185 WADGENVPKGAVVGGINDGQPLYVARSNVGGQVVVGKYFPQHGCGYFPYGGEEHRVDSVE 364 +A GE++ K GG AR + VVVG G + Y HR+D++E Sbjct: 213 YATGEHLRKAVPSGG---------ARHPIEFYVVVGDEIAGIEAGVYHYNVRHHRLDAIE 263 Query: 365 VLCCSTK 385 + S K Sbjct: 264 IASTSLK 270
>sp|Q6NVD0|FREM2_MOUSE FRAS1-related extracellular matrix protein 2 precursor (ECM3 homolog) (NV domain containing protein 1) Length = 3160 Score = 29.6 bits (65), Expect = 3.3 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 14 DQTFVARAKHEGQYIPGKLVEGWNEVFVAYGGAEHSKNYYEVLVE 148 D+ F +A+ + Q+ PG+ W ++ G EHS+ + VL E Sbjct: 1804 DRDFKGKAQKQVQFNPGQTRASWRVRILSDGEHEHSETFQVVLSE 1848
>sp|O33815|BGAL_STAXY Beta-galactosidase (Lactase) Length = 994 Score = 29.3 bits (64), Expect = 4.3 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 8/92 (8%) Frame = +2 Query: 98 AYGGAEHSKNYYEVLVESSILNHKGYEWRWADGENVPKGAVVGGINDGQPLYVARSNVGG 277 A G + + Y+ LVE G+ W W D A+ G+ DG P++ + G Sbjct: 514 AMGNSPGDLHAYQTLVEQYDSFIGGFVWEWCD------HAIQTGMKDGNPIFRYGGDFGE 567 Query: 278 QV------VVGKYFPQH--GCGYFPYGGEEHR 349 ++ V G FP GY+ + +EHR Sbjct: 568 KLHDGNFCVDGIVFPNRVPHEGYYEF-KQEHR 598
>sp|O65782|C83B1_ARATH Cytochrome P450 83B1 Length = 499 Score = 28.9 bits (63), Expect = 5.6 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +2 Query: 26 VARAKHEGQYIPGKLVEGWNEVFVAYGGAEHSKNYYEVLVESSILNHKGYEWRWADGENV 205 +A AK G IP K + N V+ A N E + E + HKG +++ D E + Sbjct: 373 IADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMNEHKGVDFKGQDFELL 432 Query: 206 PKGA 217 P G+ Sbjct: 433 PFGS 436
>sp|Q90WJ8|AJL2_ANGJA Lactose-binding lectin l-2 precursor (Ajl-2) Length = 166 Score = 28.9 bits (63), Expect = 5.6 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = +2 Query: 164 HKGYEWRWADGENVPKGAVVGGINDGQPLYVARSNVGGQVVVGKYFPQHGCGYFPYGGEE 343 H+G W W+DG + N G+P ++ GG + C + YGG++ Sbjct: 100 HEGRSWLWSDGTSASAEGDFSMWNPGEP-----NDAGG---------KEDCVHDNYGGQK 145 Query: 344 H 346 H Sbjct: 146 H 146
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,131,886 Number of Sequences: 369166 Number of extensions: 1215068 Number of successful extensions: 3709 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3703 length of database: 68,354,980 effective HSP length: 101 effective length of database: 49,696,745 effective search space used: 2484837250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)