Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_028_K07 (163 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8K9N8|LOLC_BUCAP Lipoprotein releasing system transmemb... 30 2.3 sp|P55905|A41_LEIDO Putative ubiquinone biosynthesis methyl... 28 6.6 sp|Q9ZL98|Y745_HELPJ Hypothetical RNA pseudouridine synthas... 28 8.6
>sp|Q8K9N8|LOLC_BUCAP Lipoprotein releasing system transmembrane protein lolC Length = 399 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 30 TFTIKEKSNNFRPYRIIGFTRVKFFIIKF*YGRTVSFLSNGFNS 161 T + +K NN ++ G +R K +I G T+S + N F + Sbjct: 287 TMNVLDKKNNISIFQSQGLSRYKIMLIFIILGSTISIVGNSFGT 330
>sp|P55905|A41_LEIDO Putative ubiquinone biosynthesis methyltransferase A41 (Amastigote-specific protein A41) Length = 288 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 31 HLQLKKSPTIFAPTELSDLPALNSS 105 H +K +PT PT SD+PA N+S Sbjct: 251 HTGVKTTPTPITPTTSSDIPAQNTS 275
>sp|Q9ZL98|Y745_HELPJ Hypothetical RNA pseudouridine synthase JHP0682 (RNA-uridine isomerase) (RNA pseudouridylate synthase) Length = 327 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 19 SKKPHLQLKKSPTIFAPTELSDLPALNSSLSNSDMDEQ-SVFYRTD 153 +K P+L + K+P++ PT + L + N LSN + E+ + +R D Sbjct: 91 NKPPNLVVHKAPSVKEPTLVDWLKSQNYELSNLGLKERYGIVHRLD 136
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.314 0.130 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,787,815 Number of Sequences: 369166 Number of extensions: 222908 Number of successful extensions: 503 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 68,354,980 effective HSP length: 26 effective length of database: 63,551,870 effective search space used: 1715900490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)