Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_028_G04 (269 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9I8S4|DCOR2_XENLA Ornithine decarboxylase 2 (ODC 2) (xO... 75 6e-14 sp|P09057|DCOR_RAT Ornithine decarboxylase (ODC) 73 2e-13 sp|P27119|DCOR_MUSPA Ornithine decarboxylase (ODC) 72 3e-13 sp|P00860|DCOR_MOUSE Ornithine decarboxylase (ODC) 72 3e-13 sp|P11926|DCOR_HUMAN Ornithine decarboxylase (ODC) 72 4e-13 sp|P14019|DCOR_CRIGR Ornithine decarboxylase (ODC) 72 4e-13 sp|P27118|DCOR_CHICK Ornithine decarboxylase (ODC) 72 5e-13 sp|P27117|DCOR_BOVIN Ornithine decarboxylase (ODC) 72 5e-13 sp|P41931|DCOR_CAEEL Ornithine decarboxylase (ODC) 71 9e-13 sp|P27120|DCOR1_XENLA Ornithine decarboxylase 1 (ODC 1) (xO... 71 9e-13
>sp|Q9I8S4|DCOR2_XENLA Ornithine decarboxylase 2 (ODC 2) (xODC2) Length = 456 Score = 74.7 bits (182), Expect = 6e-14 Identities = 31/59 (52%), Positives = 45/59 (76%) Frame = +2 Query: 8 FVSTIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYFM 184 + S+++GPTCDG D + ++ LP++ VG+W+++ NMGAYTIAASS FNG + VHY M Sbjct: 348 YTSSLWGPTCDGLDQIAERVQLPELHVGDWLLFENMGAYTIAASSNFNGFQQSPVHYAM 406
>sp|P09057|DCOR_RAT Ornithine decarboxylase (ODC) Length = 461 Score = 72.8 bits (177), Expect = 2e-13 Identities = 29/59 (49%), Positives = 46/59 (77%) Frame = +2 Query: 8 FVSTIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYFM 184 + S+I+GPTCDG D ++++ LP+M VG+W+++ NMGAYT+AA+S FNG +++Y M Sbjct: 351 YSSSIWGPTCDGLDRIVERCSLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVM 409
>sp|P27119|DCOR_MUSPA Ornithine decarboxylase (ODC) Length = 461 Score = 72.4 bits (176), Expect = 3e-13 Identities = 29/59 (49%), Positives = 46/59 (77%) Frame = +2 Query: 8 FVSTIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYFM 184 + S+I+GPTCDG D ++++ LP+M VG+W+++ NMGAYT+AA+S FNG +++Y M Sbjct: 351 YSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVM 409
>sp|P00860|DCOR_MOUSE Ornithine decarboxylase (ODC) Length = 461 Score = 72.4 bits (176), Expect = 3e-13 Identities = 29/59 (49%), Positives = 46/59 (77%) Frame = +2 Query: 8 FVSTIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYFM 184 + S+I+GPTCDG D ++++ LP+M VG+W+++ NMGAYT+AA+S FNG +++Y M Sbjct: 351 YSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVM 409
>sp|P11926|DCOR_HUMAN Ornithine decarboxylase (ODC) Length = 461 Score = 72.0 bits (175), Expect = 4e-13 Identities = 29/59 (49%), Positives = 45/59 (76%) Frame = +2 Query: 8 FVSTIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYFM 184 + S+I+GPTCDG D ++++ LP+M VG+W+++ NMGAYT+AA+S FNG ++Y M Sbjct: 351 YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVM 409
>sp|P14019|DCOR_CRIGR Ornithine decarboxylase (ODC) Length = 455 Score = 72.0 bits (175), Expect = 4e-13 Identities = 29/59 (49%), Positives = 45/59 (76%) Frame = +2 Query: 8 FVSTIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYFM 184 + S+I+GPTCDG D ++++ LP+M VG+W+++ NMGAYT+AA+S FNG ++Y M Sbjct: 345 YSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPSIYYVM 403
>sp|P27118|DCOR_CHICK Ornithine decarboxylase (ODC) Length = 450 Score = 71.6 bits (174), Expect = 5e-13 Identities = 28/56 (50%), Positives = 43/56 (76%) Frame = +2 Query: 17 TIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYFM 184 +I+GPTCDG D ++++ +P++ VG+WI++ NMGAYT+AA+S FNG +HY M Sbjct: 344 SIWGPTCDGLDRIVERCNMPELQVGDWILFENMGAYTVAAASTFNGFQRPTIHYVM 399
>sp|P27117|DCOR_BOVIN Ornithine decarboxylase (ODC) Length = 461 Score = 71.6 bits (174), Expect = 5e-13 Identities = 29/59 (49%), Positives = 45/59 (76%) Frame = +2 Query: 8 FVSTIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYFM 184 + S+I+GPTCDG D ++++ LP+M VG+W+++ NMGAYT+AA+S FNG ++Y M Sbjct: 351 YSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVM 409
>sp|P41931|DCOR_CAEEL Ornithine decarboxylase (ODC) Length = 422 Score = 70.9 bits (172), Expect = 9e-13 Identities = 30/64 (46%), Positives = 45/64 (70%) Frame = +2 Query: 2 ETFVSTIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYF 181 E F+STI+GPTCD D + ++ +PKM+VG W+ +P+MGAYT+AA++ FNG Y Sbjct: 348 EKFMSTIWGPTCDSLDLVEDKKLMPKMNVGEWLYYPDMGAYTLAAATTFNGFSKPVPMYV 407 Query: 182 MYQD 193 M ++ Sbjct: 408 MSEE 411
>sp|P27120|DCOR1_XENLA Ornithine decarboxylase 1 (ODC 1) (xODC1) Length = 460 Score = 70.9 bits (172), Expect = 9e-13 Identities = 28/59 (47%), Positives = 45/59 (76%) Frame = +2 Query: 8 FVSTIYGPTCDGFDCLIQQEPLPKMDVGNWIVWPNMGAYTIAASSCFNGIPMADVHYFM 184 + S+I+GPTCDG D ++++ LP++ VG+W+++ NMGAYT+AA+S FNG ++Y M Sbjct: 352 YSSSIWGPTCDGLDRIVERFELPELQVGDWMLFENMGAYTVAAASTFNGFQRPTLYYVM 410
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,364,013 Number of Sequences: 369166 Number of extensions: 689708 Number of successful extensions: 1392 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1384 length of database: 68,354,980 effective HSP length: 59 effective length of database: 57,455,615 effective search space used: 1723668450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)