Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_028_E02 (435 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q91713|CHRD_XENLA Chordin precursor (Organizer-specific ... 29 3.8 sp|Q7JLI1|NAS31_CAEEL Zinc metalloproteinase nas-31 precurs... 28 6.5 sp|Q9MUS7|RPOC2_MESVI DNA-directed RNA polymerase beta'' ch... 28 6.5
>sp|Q91713|CHRD_XENLA Chordin precursor (Organizer-specific secreted dorsalizing factor) Length = 941 Score = 29.3 bits (64), Expect = 3.8 Identities = 23/69 (33%), Positives = 26/69 (37%), Gaps = 12/69 (17%) Frame = +1 Query: 82 QRELVSNVTSKIHFQSDEVASSIGPRFYSGAVEYYSKL------------IRVNKLHHRW 225 Q EL NV +K FQ E+ I P YSG Y KL IR H W Sbjct: 496 QSELFLNVATK-DFQEGELRGQITPLLYSGLWARYEKLPVPLAGQFVSPPIRTGSAGHAW 554 Query: 226 GFTDYYTSL 252 D + L Sbjct: 555 VSLDEHCHL 563
>sp|Q7JLI1|NAS31_CAEEL Zinc metalloproteinase nas-31 precursor (Nematode astacin 31) Length = 611 Score = 28.5 bits (62), Expect = 6.5 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 232 TDYYTSLGNDVSGMFSPTNVNNHIRIGKLYHLLPAESSKEQKN 360 T+Y ++G+D G + + +N H K L PA SS + KN Sbjct: 328 TEYQDTMGSDFVGFYDISMMNEHY---KCKELCPAASSAQCKN 367
>sp|Q9MUS7|RPOC2_MESVI DNA-directed RNA polymerase beta'' chain (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1223 Score = 28.5 bits (62), Expect = 6.5 Identities = 14/61 (22%), Positives = 34/61 (55%), Gaps = 2/61 (3%) Frame = +1 Query: 34 LNAPVYIVLVL--AVFVTQRELVSNVTSKIHFQSDEVASSIGPRFYSGAVEYYSKLIRVN 207 + P+ +L++ V ++L++ V++ ++ QS E+AS +SG + + + L++ Sbjct: 414 IEVPINTILLVNNGSMVRAKQLIAEVSAPVNAQSVEIASKYVASDFSGEIHFENLLLQEK 473 Query: 208 K 210 K Sbjct: 474 K 474
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,183,129 Number of Sequences: 369166 Number of extensions: 1068334 Number of successful extensions: 2621 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2621 length of database: 68,354,980 effective HSP length: 100 effective length of database: 49,881,480 effective search space used: 2194785120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)