Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_027_L01-1 (288 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7Z602|GP141_HUMAN Probable G-protein coupled receptor 1... 29 2.9 sp|Q04503|DP87_DICDI Prespore protein DP87 precursor 28 8.5
>sp|Q7Z602|GP141_HUMAN Probable G-protein coupled receptor 141 (G-protein coupled receptor PGR13) Length = 305 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/55 (29%), Positives = 31/55 (56%) Frame = -2 Query: 239 YKKPLALYT*MMALNYC*LVFLLYIEYSPVQFQV*CLLLHLQSISHRKLLHTVYF 75 + K LA YT + +NY ++F++ + + FQV ++L +Q + H L H ++ Sbjct: 169 FHKELA-YTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFW 222
>sp|Q04503|DP87_DICDI Prespore protein DP87 precursor Length = 555 Score = 27.7 bits (60), Expect = 8.5 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 1 IIYSFHSIFLFSYYLSSVWNWIVGRK*TVCNNLRCEILCRCNK 129 I+Y +FL + YLS + W GR C + R E C+ ++ Sbjct: 3 ILYLASLLFLITLYLSPTFGWGGGRD---CESHRSEYTCKSDR 42
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,937,850 Number of Sequences: 369166 Number of extensions: 607138 Number of successful extensions: 1455 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1455 length of database: 68,354,980 effective HSP length: 65 effective length of database: 56,347,205 effective search space used: 1690416150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)