Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_027_J23 (266 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8M9X3|CEMA_CHAGL Chloroplast envelope membrane protein 30 2.3 sp|P25247|POL2_TORVR RNA2 polyprotein (P2) [Contains: X3 pr... 28 8.7
>sp|Q8M9X3|CEMA_CHAGL Chloroplast envelope membrane protein Length = 472 Score = 29.6 bits (65), Expect = 2.3 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Frame = -3 Query: 177 TTKNFEFFFLMF----DSSVREISAPLFRLKFPYDSFRFNFTFDNKK 49 T KNF F FL + + + + A L LK D + +NF F NKK Sbjct: 140 TNKNFHFDFLKYKIKYERQLAWVEAVLEDLKIWKDFYLYNFDFFNKK 186
>sp|P25247|POL2_TORVR RNA2 polyprotein (P2) [Contains: X3 protein; X4 protein; Movement protein (MP); Coat protein (CP)] Length = 1882 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/62 (24%), Positives = 29/62 (46%) Frame = -1 Query: 203 KVFYKCFVTQQRISNSSFSCSIPPYGK*AHPCSG*NFPTTVSALISLLTIKRGRPLSDPP 24 K+ +CF+ S CS+ +G+ G +FP +++L+ I L+D P Sbjct: 1377 KLRLRCFIPTNIFCGHSMMCSLDAFGRYDSNVLGASFPVKLASLLPTEVIS----LADGP 1432 Query: 23 II 18 ++ Sbjct: 1433 VV 1434
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,937,146 Number of Sequences: 369166 Number of extensions: 527118 Number of successful extensions: 1133 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1133 length of database: 68,354,980 effective HSP length: 58 effective length of database: 57,640,350 effective search space used: 1729210500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)