Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_026_O10 (281 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O02649|CH60_DROME 60 kDa heat shock protein, mitochondri... 79 3e-15 sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondri... 79 4e-15 sp|P63039|CH60_RAT 60 kDa heat shock protein, mitochondrial... 78 6e-15 sp|P18687|CH60_CRIGR 60 kDa heat shock protein, mitochondri... 78 6e-15 sp|Q5NVM5|CH60_PONPY 60 kDa heat shock protein, mitochondri... 75 4e-14 sp|P25420|CH63_HELVI 63 kDa chaperonin, mitochondrial precu... 74 8e-14 sp|Q9VMN5|CH60C_DROME Probable 60 kDa heat shock protein ho... 73 2e-13 sp|Q9VPS5|CH60B_DROME Probable 60 kDa heat shock protein ho... 70 2e-12 sp|P50140|CH60_CAEEL Chaperonin homolog HSP60, mitochondria... 69 3e-12 sp|P35480|CH60_BRANA Chaperonin CPN60, mitochondrial precursor 65 4e-11
>sp|O02649|CH60_DROME 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) Length = 573 Score = 79.0 bits (193), Expect = 3e-15 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDDKASA 160 A+ EY N+IEKGIIDPTKVVRTA+ DASGVASLLTTAE VVTEI K+D A A Sbjct: 501 ALKGEYGNLIEKGIIDPTKVVRTAITDASGVASLLTTAEAVVTEIPKEDGAPA 553
>sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (P60 lymphocyte protein) (HuCHA60) Length = 573 Score = 78.6 bits (192), Expect = 4e-15 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDDK 151 AM ++VNM+EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI K++K Sbjct: 505 AMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEK 554
>sp|P63039|CH60_RAT 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65) sp|P63038|CH60_MOUSE 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) (HSP-65) Length = 573 Score = 78.2 bits (191), Expect = 6e-15 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDDK 151 AM ++VNM+EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI K++K Sbjct: 505 AMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEK 554
>sp|P18687|CH60_CRIGR 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) (Mitochondrial matrix protein P1) Length = 573 Score = 78.2 bits (191), Expect = 6e-15 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDDK 151 AM ++VNM+EKGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI K++K Sbjct: 505 AMLGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEK 554
>sp|Q5NVM5|CH60_PONPY 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) Length = 573 Score = 75.5 bits (184), Expect = 4e-14 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDDK 151 AM ++VNM+ KGIIDPTKVVRTAL+DA+GVASLLTTAE VVTEI K++K Sbjct: 505 AMVGDFVNMVGKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPKEEK 554
>sp|P25420|CH63_HELVI 63 kDa chaperonin, mitochondrial precursor (p63) Length = 569 Score = 74.3 bits (181), Expect = 8e-14 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIK 142 A+N+EYVNMIEKGIIDPTKVVR AL DASGVASLLTTAE V+ ++ K Sbjct: 507 ALNNEYVNMIEKGIIDPTKVVRRALTDASGVASLLTTAEAVICDMPK 553
>sp|Q9VMN5|CH60C_DROME Probable 60 kDa heat shock protein homolog 2, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) Length = 576 Score = 73.2 bits (178), Expect = 2e-13 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDDKASA 160 A+ EY NMIE+GIIDPTKVVRTA+ DA+GVASLLTTAE VVTE+ ++ A+A Sbjct: 505 ALKGEYGNMIERGIIDPTKVVRTAISDAAGVASLLTTAEAVVTELPLEEAAAA 557
>sp|Q9VPS5|CH60B_DROME Probable 60 kDa heat shock protein homolog 1, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock protein 60) (HSP-60) Length = 648 Score = 69.7 bits (169), Expect = 2e-12 Identities = 33/52 (63%), Positives = 41/52 (78%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDDKAS 157 AM DEY ++EKGIIDPTKV+RTA+ DA+GVASLL+T E V+T+ DD S Sbjct: 500 AMGDEYCRLVEKGIIDPTKVLRTAITDAAGVASLLSTTEVVITDSRNDDLLS 551
>sp|P50140|CH60_CAEEL Chaperonin homolog HSP60, mitochondrial precursor (Heat shock protein 60) (HSP-60) Length = 568 Score = 68.9 bits (167), Expect = 3e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDD 148 A+N ++V+M E GIIDPTKVVRTAL DASGVASLL T E VVTEI K++ Sbjct: 497 ALNGKFVDMFEAGIIDPTKVVRTALQDASGVASLLATTECVVTEIPKEE 545
>sp|P35480|CH60_BRANA Chaperonin CPN60, mitochondrial precursor Length = 587 Score = 65.5 bits (158), Expect = 4e-11 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +2 Query: 2 AMNDEYVNMIEKGIIDPTKVVRTALVDASGVASLLTTAETVVTEIIKDDKAS 157 A EYV+M++ GIIDP KV+RTALVDA+ V+SLLTT E VVTEI + AS Sbjct: 515 AAKGEYVDMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDAS 566
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,343,971 Number of Sequences: 369166 Number of extensions: 190039 Number of successful extensions: 907 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 907 length of database: 68,354,980 effective HSP length: 63 effective length of database: 56,716,675 effective search space used: 1701500250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)