Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_026_N22 (939 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O44400|F37C4_CAEEL Protein F37C4.5 52 2e-06 sp|Q01118|SCN7A_HUMAN Sodium channel protein type VII alpha... 30 7.5
>sp|O44400|F37C4_CAEEL Protein F37C4.5 Length = 556 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/85 (30%), Positives = 43/85 (50%) Frame = +1 Query: 538 KTELKTVAPGEEFSCHLGADHRIQISYHPMYKYREGSAPISKTICIAFKQVIEILNHHSK 717 KTE + ++F LG D I+I Y P+ Y+E S + K ++ + N Sbjct: 414 KTEFEDAVVSQKFEVSLGVDPNIRIEYKPVRNYQEQSGTVEKINSQVTEKTTAVTNLRPN 473 Query: 718 SIKMTLMDQLPIANEDKIKVVLQEP 792 S+ +T+ +QLP + + +IKV L P Sbjct: 474 SVLLTIREQLPRSTDSRIKVHLNTP 498
>sp|Q01118|SCN7A_HUMAN Sodium channel protein type VII alpha subunit (Putative voltage-gated sodium channel alpha subunit Nax) (Sodium channel protein, cardiac and skeletal muscle alpha-subunit) Length = 1682 Score = 30.4 bits (67), Expect = 7.5 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 5/65 (7%) Frame = +1 Query: 655 ISKTICIAFKQVIEILNH-----HSKSIKMTLMDQLPIANEDKIKVVLQEPTIKHPEKYD 819 ISK I F+Q + L +K+I++ + + PI+ + + V L++ T++H E+ + Sbjct: 407 ISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDV-LEDATLRHKEELE 465 Query: 820 KSKSI 834 KSK I Sbjct: 466 KSKKI 470
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,503,454 Number of Sequences: 369166 Number of extensions: 1804568 Number of successful extensions: 3959 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3957 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 9702894260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)