Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_026_L16 (628 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P26192|VP3_ROTPC Inner core protein VP3 32 1.7 sp|P51136|GSK3H_DICDI Glycogen synthase kinase-3 homolog (G... 30 6.6
>sp|P26192|VP3_ROTPC Inner core protein VP3 Length = 692 Score = 31.6 bits (70), Expect = 1.7 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 8/91 (8%) Frame = +1 Query: 115 YLEDLVMSSNEPVKNINVYPINFFRRIYTKPFHMFFDAIEP--IIGKHYSGIFRSSI--- 279 Y E+ + SN+ I +Y + K F + P +I K + GIF SS Sbjct: 29 YHENAFLISNQVATTIIIYLSDTIVNEVDKAFTLLNSNGIPALVIRKDHIGIFTSSNFTY 88 Query: 280 ---HKVVFFFGAIYYATYKLKFGDTDWTHAS 363 HK+V+F YY + D W H + Sbjct: 89 DWQHKIVYFHEYTYYKNNEFIVSDEFWLHTN 119
>sp|P51136|GSK3H_DICDI Glycogen synthase kinase-3 homolog (GSK-3) Length = 467 Score = 29.6 bits (65), Expect = 6.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +1 Query: 427 VMTKQTADFDDRDFSKRTVLKDVVKTSTMISTPRDK*FRKLLMKSGN*CFV 579 ++ K + DD K T +S+ S PR F K+++KS C++ Sbjct: 7 ILEKDKKETDDNGNKKTTTTTSSSSSSSSSSKPRSNKFDKVIIKSNGVCYI 57
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,016,679 Number of Sequences: 369166 Number of extensions: 1278161 Number of successful extensions: 3006 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2952 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3006 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 4974853140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)