Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_026_H24 (590 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P42322|CANB1_NAEGR Calcineurin B subunit (Protein phosph... 30 3.5 sp|P87072|CANB_NEUCR Calcineurin B subunit (Protein phospha... 30 4.5
>sp|P42322|CANB1_NAEGR Calcineurin B subunit (Protein phosphatase 2B regulatory subunit) (Calcineurin regulatory subunit) Length = 177 Score = 30.4 bits (67), Expect = 3.5 Identities = 14/59 (23%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 290 FCEMDKNNNGNLDRSEIALLSQL-LNPSTPCLNTFLSKCGSGTISFSAWNSCFKVPKAE 463 F ++DK+ NG + + E ++ +L +NP + + + G G+++F + + V A+ Sbjct: 34 FKKLDKDGNGTISKDEFLMIPELAVNPLVKRVISIFDENGDGSVNFKEFIAALSVFNAQ 92
>sp|P87072|CANB_NEUCR Calcineurin B subunit (Protein phosphatase 2B regulatory subunit) (Calcineurin regulatory subunit) Length = 174 Score = 30.0 bits (66), Expect = 4.5 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 290 FCEMDKNNNGNLDRSEIALLSQL-LNPSTPCLNTFLSKCGSGTISFSAWNS 439 F ++DK+N+G ++R E L Q+ NP + + G G + F + S Sbjct: 30 FMKLDKDNSGTIEREEFLSLPQISTNPLATRMIAIFDEDGGGDVDFQEFVS 80
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,273,240 Number of Sequences: 369166 Number of extensions: 1214225 Number of successful extensions: 2320 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2320 length of database: 68,354,980 effective HSP length: 105 effective length of database: 48,957,805 effective search space used: 4455160255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)