Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_026_E20 (242 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O02626|AEX3_CAEEL Regulator of presynaptic activity aex-3 30 1.7 sp|O35867|NEB1_RAT Neurabin-1 (Neurabin-I) (Neural tissue-s... 29 3.9
>sp|O02626|AEX3_CAEEL Regulator of presynaptic activity aex-3 Length = 1409 Score = 30.0 bits (66), Expect = 1.7 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 13/62 (20%) Frame = +1 Query: 94 SLVTPSSRSNNNYQQ-------------TSRYPLNYRSTPSSQNNYYYQQTSRYPRYPRA 234 ++ TPS SN+ ++ T PL TP+S NN+ Q++R P P Sbjct: 908 TMTTPSEHSNDILKESRPKLPASTIDLRTPTKPLGQNVTPTSTNNHEIAQSTRSPALPPP 967 Query: 235 TP 240 P Sbjct: 968 VP 969
>sp|O35867|NEB1_RAT Neurabin-1 (Neurabin-I) (Neural tissue-specific F-actin binding protein I) (Protein phosphatase 1 regulatory subunit 9A) (p180) (PP1bp175) Length = 1095 Score = 28.9 bits (63), Expect = 3.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 88 SMSLVTPSSRSNNNYQQTSRYPLNYRS 168 S +TP N+NY T YPLN S Sbjct: 214 SPGAITPGKAENSNYSVTGHYPLNLPS 240
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.307 0.120 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,803,424 Number of Sequences: 369166 Number of extensions: 346285 Number of successful extensions: 684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 68,354,980 effective HSP length: 51 effective length of database: 58,933,495 effective search space used: 1709071355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)