Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_026_C12 (131 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O96952|THIO_GEOCY Thioredoxin 57 1e-08 sp|Q9DGI3|THIO_ICTPU Thioredoxin 57 2e-08 sp|P22803|TRX2_YEAST Thioredoxin II (TR-II) (Thioredoxin 1) 53 2e-07 sp|P22217|TRX1_YEAST Thioredoxin I (TR-I) (Thioredoxin 2) 50 2e-06 sp|P08628|THIO_RABIT Thioredoxin 49 3e-06 sp|P10599|THIO_HUMAN Thioredoxin (ATL-derived factor) (ADF)... 49 3e-06 sp|Q5R9M3|THIO_PONPY Thioredoxin 49 3e-06 sp|Q9UW02|THIO_COPCM Thioredoxin (Allergen Cop c 2) 49 4e-06 sp|Q69AB2|TXND8_MOUSE Thioredoxin domain-containing protein... 49 5e-06 sp|Q6P902|TXND2_MOUSE Thioredoxin domain-containing protein... 49 5e-06
>sp|O96952|THIO_GEOCY Thioredoxin Length = 106 Score = 57.0 bits (136), Expect = 1e-08 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +3 Query: 6 LKTLTEFNEVLKST-DKLIVVDFTAKWCGPCQRIGPVFVSFSQ 131 LKT +F++ LK DKL+V+DFTA WCGPCQRI P +V ++ Sbjct: 5 LKTKADFDQALKDAGDKLVVIDFTASWCGPCQRIAPKYVEMAK 47
>sp|Q9DGI3|THIO_ICTPU Thioredoxin Length = 107 Score = 56.6 bits (135), Expect = 2e-08 Identities = 24/43 (55%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +3 Query: 6 LKTLTEFNEVLKST-DKLIVVDFTAKWCGPCQRIGPVFVSFSQ 131 ++ L F+ LK+ DKL+VVDFTA WCGPCQ+IGP+F + S+ Sbjct: 5 IENLNAFSAALKNAGDKLVVVDFTATWCGPCQKIGPIFETLSK 47
>sp|P22803|TRX2_YEAST Thioredoxin II (TR-II) (Thioredoxin 1) Length = 104 Score = 53.1 bits (126), Expect = 2e-07 Identities = 21/43 (48%), Positives = 31/43 (72%) Frame = +3 Query: 3 ELKTLTEFNEVLKSTDKLIVVDFTAKWCGPCQRIGPVFVSFSQ 131 +LK+ +E++ L S DKL+VVDF A WCGPC+ I P+ F++ Sbjct: 4 QLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAE 46
>sp|P22217|TRX1_YEAST Thioredoxin I (TR-I) (Thioredoxin 2) Length = 103 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/43 (48%), Positives = 30/43 (69%) Frame = +3 Query: 3 ELKTLTEFNEVLKSTDKLIVVDFTAKWCGPCQRIGPVFVSFSQ 131 + KT +EF+ + + DKL+VVDF A WCGPC+ I P+ FS+ Sbjct: 4 QFKTASEFDSAI-AQDKLVVVDFYATWCGPCKMIAPMIEKFSE 45
>sp|P08628|THIO_RABIT Thioredoxin Length = 104 Score = 49.3 bits (116), Expect = 3e-06 Identities = 22/44 (50%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +3 Query: 3 ELKTLTEFNEVLKST-DKLIVVDFTAKWCGPCQRIGPVFVSFSQ 131 ++++ + F EVL S DKL+VVDF+A WCGPC+ I P F + S+ Sbjct: 3 QIESKSAFQEVLDSAGDKLVVVDFSATWCGPCKMIKPFFHALSE 46
>sp|P10599|THIO_HUMAN Thioredoxin (ATL-derived factor) (ADF) (Surface associated sulphydryl protein) (SASP) Length = 105 Score = 49.3 bits (116), Expect = 3e-06 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = +3 Query: 3 ELKTLTEFNEVLKST-DKLIVVDFTAKWCGPCQRIGPVFVSFSQ 131 ++++ T F E L + DKL+VVDF+A WCGPC+ I P F S S+ Sbjct: 4 QIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSE 47
>sp|Q5R9M3|THIO_PONPY Thioredoxin Length = 106 Score = 49.3 bits (116), Expect = 3e-06 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = +3 Query: 3 ELKTLTEFNEVLKST-DKLIVVDFTAKWCGPCQRIGPVFVSFSQ 131 ++++ T F E L + DKL+VVDF+A WCGPC+ I P F S S+ Sbjct: 4 QIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSE 47
>sp|Q9UW02|THIO_COPCM Thioredoxin (Allergen Cop c 2) Length = 106 Score = 48.9 bits (115), Expect = 4e-06 Identities = 20/42 (47%), Positives = 30/42 (71%) Frame = +3 Query: 6 LKTLTEFNEVLKSTDKLIVVDFTAKWCGPCQRIGPVFVSFSQ 131 + L EFN+ L ++ K+I++DF A WCGPC+ I P+F FS+ Sbjct: 5 ISNLDEFNK-LTNSGKIIIIDFWATWCGPCRVISPIFEKFSE 45
>sp|Q69AB2|TXND8_MOUSE Thioredoxin domain-containing protein 8 (Spermatid-specific thioredoxin-3) (Sptrx-3) (Thioredoxin-6) Length = 127 Score = 48.5 bits (114), Expect = 5e-06 Identities = 20/42 (47%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = +3 Query: 6 LKTLTEFNEVLKST-DKLIVVDFTAKWCGPCQRIGPVFVSFS 128 +K ++E E+ +KL+VV+F+AKWCGPC+ I PVF + S Sbjct: 5 IKNMSELKELFSDAGNKLVVVEFSAKWCGPCKTIAPVFQAMS 46
>sp|Q6P902|TXND2_MOUSE Thioredoxin domain-containing protein 2 (Spermatid-specific thioredoxin-1) (Sptrx-1) (Thioredoxin-4) Length = 515 Score = 48.5 bits (114), Expect = 5e-06 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +3 Query: 6 LKTLTEFNEVLKST-DKLIVVDFTAKWCGPCQRIGPVFVSFS 128 +K EF EVLK +KL+ VDF+A WCGPC+ + P+F S S Sbjct: 415 IKDKEEFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLS 456
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,395,105 Number of Sequences: 369166 Number of extensions: 165773 Number of successful extensions: 863 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 68,354,980 effective HSP length: 17 effective length of database: 65,214,485 effective search space used: 1695576610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)