Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_026_A05 (396 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q05856|RSMB_DROME Small nuclear ribonucleoprotein associ... 44 9e-05 sp|P91918|RSMB_CAEEL Probable small nuclear ribonucleoprote... 44 1e-04 sp|P14678|RSMB_HUMAN Small nuclear ribonucleoprotein associ... 40 0.002 sp|P27048|RSMB_MOUSE Small nuclear ribonucleoprotein associ... 40 0.002 sp|P63162|RSMN_HUMAN Small nuclear ribonucleoprotein associ... 40 0.002 sp|Q9PV94|RSMB_CHICK Small nuclear ribonucleoprotein associ... 40 0.002 sp|Q9TU66|RSMB_MONDO Small nuclear ribonucleoprotein associ... 40 0.002 sp|Q9TU67|RSMB_ERIEU Small nuclear ribonucleoprotein associ... 40 0.002 sp|P17136|RSMB_RAT Small nuclear ribonucleoprotein associat... 40 0.002 sp|Q10163|YAU8_SCHPO Hypothetical protein C26A3.08 in chrom... 40 0.002
>sp|Q05856|RSMB_DROME Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) Length = 199 Score = 44.3 bits (103), Expect = 9e-05 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTED 88 KR LGFVL+RGE +VSL V+GPPP E+ Sbjct: 64 KRVLGFVLLRGENIVSLTVEGPPPPEE 90
>sp|P91918|RSMB_CAEEL Probable small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) Length = 160 Score = 43.9 bits (102), Expect = 1e-04 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTEDSA 94 KR LG VL+RGE +VS+ VDGPPP +D + Sbjct: 64 KRILGLVLVRGEHIVSMTVDGPPPRDDDS 92
>sp|P14678|RSMB_HUMAN Small nuclear ribonucleoprotein associated proteins B and B' (snRNP-B) (Sm protein B/B') (Sm-B/Sm-B') (SmB/SmB') Length = 240 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTE 85 KR LG VL+RGE LVS+ V+GPPP + Sbjct: 64 KRVLGLVLLRGENLVSMTVEGPPPKD 89
>sp|P27048|RSMB_MOUSE Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) Length = 231 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTE 85 KR LG VL+RGE LVS+ V+GPPP + Sbjct: 64 KRVLGLVLLRGENLVSMTVEGPPPKD 89
>sp|P63162|RSMN_HUMAN Small nuclear ribonucleoprotein associated protein N (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) sp|P63164|RSMN_RAT Small nuclear ribonucleoprotein associated protein N (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) sp|P63163|RSMN_MOUSE Small nuclear ribonucleoprotein associated protein N (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTE 85 KR LG VL+RGE LVS+ V+GPPP + Sbjct: 64 KRVLGLVLLRGENLVSMTVEGPPPKD 89
>sp|Q9PV94|RSMB_CHICK Small nuclear ribonucleoprotein associated protein B' (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTE 85 KR LG VL+RGE LVS+ V+GPPP + Sbjct: 64 KRVLGLVLLRGENLVSMTVEGPPPKD 89
>sp|Q9TU66|RSMB_MONDO Small nuclear ribonucleoprotein associated protein B' (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTE 85 KR LG VL+RGE LVS+ V+GPPP + Sbjct: 64 KRVLGLVLLRGENLVSMTVEGPPPKD 89
>sp|Q9TU67|RSMB_ERIEU Small nuclear ribonucleoprotein associated protein B' (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTE 85 KR LG VL+RGE LVS+ V+GPPP + Sbjct: 64 KRVLGLVLLRGENLVSMTVEGPPPKD 89
>sp|P17136|RSMB_RAT Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) (SM11) Length = 214 Score = 40.0 bits (92), Expect = 0.002 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTE 85 KR LG VL+RGE LVS+ V+GPPP + Sbjct: 47 KRVLGLVLLRGENLVSMTVEGPPPKD 72
>sp|Q10163|YAU8_SCHPO Hypothetical protein C26A3.08 in chromosome I Length = 147 Score = 39.7 bits (91), Expect = 0.002 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = +2 Query: 8 KRSLGFVLIRGEQLVSLNVDGPPPTEDSAK 97 KR LG V++RGE +VSL+V GPPP + S + Sbjct: 62 KRMLGLVILRGEFIVSLSVQGPPPMDPSMR 91
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,849,734 Number of Sequences: 369166 Number of extensions: 601314 Number of successful extensions: 1901 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1900 length of database: 68,354,980 effective HSP length: 97 effective length of database: 50,435,685 effective search space used: 1714813290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)