Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_025_O21 (286 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P58242|AS3B_MOUSE Acid sphingomyelinase-like phosphodies... 33 0.16 sp|P42836|PFA3_YEAST Palmitoyltransferase PFA3 (Protein fat... 28 6.5 sp|P79457|UTY_MOUSE Ubiquitously transcribed Y chromosome t... 28 6.5
>sp|P58242|AS3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b precursor (ASM-like phosphodiesterase 3b) Length = 456 Score = 33.5 bits (75), Expect = 0.16 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = -1 Query: 259 IPSMFSNTFHTRMNHICHISHIFRNYRIYHVFRICHI-CHISRIFRICHVCHVFHICRIY 83 +P ++ HT + I HI + Y +Y+ H+ C S C + H+C I Sbjct: 367 VPDASVSSMHTALTRIASEPHILQRYYVYNSVSYNHLTCEDS--------CRIEHVCAIQ 418 Query: 82 HIFRNNH 62 H+ N + Sbjct: 419 HVAFNTY 425
>sp|P42836|PFA3_YEAST Palmitoyltransferase PFA3 (Protein fatty acyltransferase 3) Length = 336 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 166 FRICHICHISRIFRICHVCHVFHIC 92 FR+C +CH+ + R CH C +C Sbjct: 103 FRVCQVCHVWKPDR-CHHCSSCDVC 126
>sp|P79457|UTY_MOUSE Ubiquitously transcribed Y chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein ON the Y chromosome) (Male-specific histocompatibility antigen H-YDB) Length = 1212 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = -1 Query: 157 CHICHISRIFRICHVCHVFHICRIYHIFRNNHQQLRKL 44 C++C +S + H+ H++ R YH + ++QL ++ Sbjct: 192 CNVCTLSSVEIQFHIAHLYETQRKYHSAKAAYEQLLQI 229
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,604,931 Number of Sequences: 369166 Number of extensions: 200319 Number of successful extensions: 549 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 68,354,980 effective HSP length: 64 effective length of database: 56,531,940 effective search space used: 1695958200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)