Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_025_L12 (302 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P36029|YKR4_YEAST Hypothetical amino-acid permease in ST... 29 3.0 sp|Q34048|NU4M_CERCA NADH-ubiquinone oxidoreductase chain 4... 28 5.1
>sp|P36029|YKR4_YEAST Hypothetical amino-acid permease in STE3-GIN10 intergenic region Length = 618 Score = 29.3 bits (64), Expect = 3.0 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +2 Query: 116 FHWYHQQLKFPVEFDIN--IGSQMELTVYDDKGHAVNKSINGGTNIKE 253 F W + P+ DI I S E TV++ + V ++N GT +KE Sbjct: 516 FKWGKYNFRLPLADDIKAPIPSDAEETVFELEDSNVEHTLNSGTTVKE 563
>sp|Q34048|NU4M_CERCA NADH-ubiquinone oxidoreductase chain 4 (NADH dehydrogenase subunit 4) Length = 446 Score = 28.5 bits (62), Expect = 5.1 Identities = 14/56 (25%), Positives = 29/56 (51%) Frame = -2 Query: 232 INRFIYCMTFVVINS*FHLRANINVEFNRKFQLLVVPMKIFAFW*TNLYICVHFSI 65 ++ ++ +TFV+I F L +N+ + F +L + + +FW +L I S+ Sbjct: 24 VHNLLFVITFVLILMNFCLNYFVNISYFMGFDVLSYGLILLSFWICSLMIVASESV 79
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,333,059 Number of Sequences: 369166 Number of extensions: 637196 Number of successful extensions: 1258 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1255 length of database: 68,354,980 effective HSP length: 69 effective length of database: 55,608,265 effective search space used: 1723856215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)