Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_025_K23 (365 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB 30 1.7 sp|P57286|SODM_BUCAI Superoxide dismutase [Mn] 29 3.0 sp|Q90WJ8|AJL2_ANGJA Lactose-binding lectin l-2 precursor (... 29 3.9 sp|O33815|BGAL_STAXY Beta-galactosidase (Lactase) 28 8.6
>sp|P42724|TFXB_RHILT Trifolitoxin processing protein tfxB Length = 373 Score = 30.0 bits (66), Expect = 1.7 Identities = 20/67 (29%), Positives = 29/67 (43%) Frame = +1 Query: 91 WADGENVPKGAVVGGINDGQPLYVARSNVGGQVVVGKYFPQHGCGYFPYGGEEHRVDSVE 270 +A GE++ K GG AR + VVVG G + Y HR+D++E Sbjct: 213 YATGEHLRKAVPSGG---------ARHPIEFYVVVGDEIAGIEAGVYHYNVRHHRLDAIE 263 Query: 271 VLCCSTK 291 + S K Sbjct: 264 IASTSLK 270
>sp|P57286|SODM_BUCAI Superoxide dismutase [Mn] Length = 203 Score = 29.3 bits (64), Expect = 3.0 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = +1 Query: 1 EFGTRAEHSKNYYEVLVESSILNHKGYEWRWADGENVPKGAVVGGINDGQPLY-VARSNV 177 +FGT E + + ES LNH G W W +N ++V +N PL SN Sbjct: 105 QFGTIDEFKEKF-----ESVALNHFGSGWVWLVNQNGVL-SIVSTVNQDSPLMGKLISNT 158 Query: 178 GGQVVVGKYFPQHGCGYFPYGGEEHRVDSVE 270 G ++G +H Y Y + R+D ++ Sbjct: 159 YGYPIIGLDIWEHAY-YLKY--QNRRLDYIK 186
>sp|Q90WJ8|AJL2_ANGJA Lactose-binding lectin l-2 precursor (Ajl-2) Length = 166 Score = 28.9 bits (63), Expect = 3.9 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = +1 Query: 70 HKGYEWRWADGENVPKGAVVGGINDGQPLYVARSNVGGQVVVGKYFPQHGCGYFPYGGEE 249 H+G W W+DG + N G+P ++ GG + C + YGG++ Sbjct: 100 HEGRSWLWSDGTSASAEGDFSMWNPGEP-----NDAGG---------KEDCVHDNYGGQK 145 Query: 250 H 252 H Sbjct: 146 H 146
>sp|O33815|BGAL_STAXY Beta-galactosidase (Lactase) Length = 994 Score = 27.7 bits (60), Expect = 8.6 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 8/81 (9%) Frame = +1 Query: 37 YEVLVESSILNHKGYEWRWADGENVPKGAVVGGINDGQPLYVARSNVGGQV------VVG 198 Y+ LVE G+ W W D A+ G+ DG P++ + G ++ V G Sbjct: 525 YQTLVEQYDSFIGGFVWEWCD------HAIQTGMKDGNPIFRYGGDFGEKLHDGNFCVDG 578 Query: 199 KYFPQH--GCGYFPYGGEEHR 255 FP GY+ + +EHR Sbjct: 579 IVFPNRVPHEGYYEF-KQEHR 598
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,066,076 Number of Sequences: 369166 Number of extensions: 915415 Number of successful extensions: 2667 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2662 length of database: 68,354,980 effective HSP length: 88 effective length of database: 52,098,300 effective search space used: 1719243900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)